trcS Family assigned · medium auto-curated

H37Rv Rv1032c · MTBC0 mtbc0_001111 · 509 aa · 1163763–1165292 (-) · RefSeq NP_215548.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component sensor histidine kinase TrcS
MTBC0 PGAP re-annotationHAMP domain-containing sensor histidine kinase
Revised (this work)HAMP domain-containing sensor histidine kinase. Pfam: HisKA (PF00512.32), HATPase_c (PF02518.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96368 SwissProt · reviewed · Evidence at protein level
UniProt nameSensor histidine kinase TrcS
EC (curated) EC 2.7.13.3
Curated functionMember of the two-component regulatory system TrcS/TrcR. Phosphorylates TrcR. The TrcR-TrcS regulatory system may act as a transition regulatory system involved in adapting to an intracellular environment and transitioning from latency to reactivation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred nametrcS
eggNOG descriptionHistidine kinase
Orthologous groupCOG0642
EC number EC 2.7.13.3
KEGG orthology K02484, K07656
KEGG pathways map02020
KEGG modules M00463

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.625 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HisKAPF00512.32 2.2e-19278–344 His Kinase A (phospho-acceptor) domain
HATPase_cPF02518.32 2.6e-26387–500 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trcR (two component transcriptional regulator TrcR), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1033c trcR two component transcriptional regulator TrcR 999 999 ctx neighborhood:881 cooccurence:769 database:900 textmining:830
Rv1027c kdpE transcriptional regulator KdpE 925 913 ctx neighborhood:544 cooccurence:591
Rv3765c tcrX two component transcriptional regulator TcrX 922 900 ctx cooccurence:771
Rv0903c prrA two component transcriptional regulator PrrA 903 879 ctx cooccurence:724
Rv0491 regX3 two component sensory transduction protein RegX 886 879 ctx cooccurence:723
Rv0757 phoP two component system response transcriptional positive regulator PhoP 896 878 ctx cooccurence:720
Rv3246c mtrA two component DNA-binding response regulator MtrA 892 877 ctx cooccurence:719
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 899 872 ctx cooccurence:706
Rv0981 mprA two-component response regulator MrpA 883 867 ctx cooccurence:694
Rv2884 transcriptional regulator 806 795 ctx cooccurence:526
Rv0818 transcriptional regulator 758 743 ctx cooccurence:412
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 757 728 experimental:422 database:538
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 741 727 database:590
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 722 711 experimental:401 database:538
Rv1734c hyp hypothetical protein 722 711 experimental:401 database:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two component sensor histidine kinase TrcS
  • MTBC0 PGAP product: HAMP domain-containing sensor histidine kinase
  • Pfam (hmmscan --cut_ga): HisKA PF00512.32 (E=2e-19), HATPase_c PF02518.32 (E=3e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215548.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HisKA (PF00512.32), HATPase_c (PF02518.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0642
  • Curated reference: UniProt P96368 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 62 functional partner(s); context anchor trcR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001111|Rv1032c|trcS
MIPDRNTRSRKAPCWRPRSLRQQLLLGVLAVVTVVLVAVGVVSVLSLSGYVTAMNDAELVESLHALNHSYTRYRDSAQTSTPTGNLPMSQAVLEFTGQTPGNLIAVLHDGVVIGSAVFSEDGARPAPPDVIRAIEAQVWDGGPPRVESLGSLGAYQVDSSAAGADRLFVGVSLSLANQIIARKKVTTVALVGAALVVTAALTVWVVGYALRPLRRVAATAAEVATMPLTDDDHQISVRVRPGDTDPDNEVGIVGHTLNRLLDNVDGALAHRVDSDLRMRQFITDASHELRTPLAAIQGYAELTRQDSSDLPPTTEYALARIESEARRMTLLVDELLLLSRLSEGEDLETEDLDLTDLVINAVNDAAVAAPTHRWVKNLPDEPVWVNGDHARLHQLVSNLLTNAWVHTQPGVTVTIGITCHRTGPNAPCVELSVTDDGPDIDPEILPHLFDRFVRASKSRSNGSGHGLGLAIVSSIVKAHRGSVTAESGNGQTVFRVRLPMIEQQIATTA