echA5 Resolved · high auto-curated
H37Rv Rv0675 · MTBC0 - ·
263 aa · 774783–775574 (+) ·
RefSeq YP_177745.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | enoyl-CoA hydratase EchA5 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Enoyl-CoA hydratase EchA5. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6Y4E8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable enoyl-CoA hydratase EchA5 |
| Curated function | Could possibly oxidize fatty acids using specific components. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | echA5 |
| eggNOG description | Belongs to the enoyl-CoA hydratase isomerase family |
| Orthologous group | COG1024 |
| EC number |
EC 4.2.1.17
|
| KEGG orthology |
K01692
|
| KEGG pathways |
map00071, map00280, map00281, map00310, map00360, map00362, map00380, map00410, map00627, map00640, map00650, map00903, map00930, map01100, map01110, map01120, map01130, map01212
|
| KEGG modules |
M00032, M00087
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.124 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (246) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ECH_1 | PF00378.26 | 5.5e-42 | 9–205 | Enoyl-CoA hydratase/isomerase |
ECH_2 | PF16113.11 | 4.3e-19 | 14–196 | Enoyl-CoA hydratase/isomerase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fadE8 (acyl-CoA dehydrogenase FadE8), high confidence from genomic context alone (score 958 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0672 fadE8 |
acyl-CoA dehydrogenase FadE8 | 959 | 958 ctx | neighborhood:874 coexpression:487 |
Rv0673 echA4 |
enoyl-CoA hydratase EchA4 | 931 | 931 ctx | neighborhood:881 |
Rv0674 hyp |
hypothetical protein | 886 | 882 ctx | neighborhood:881 |
Rv0468 fadB2 |
3-hydroxybutyryl-CoA dehydrogenase | 861 | 856 | database:650 |
Rv0400c fadE7 |
acyl-CoA dehydrogenase FadE7 | 853 | 846 | database:750 |
Rv0975c fadE13 |
acyl-CoA dehydrogenase FadE13 | 852 | 845 | database:750 |
Rv2500c fadE19 |
acyl-CoA dehydrogenase FadE19 | 852 | 845 | database:750 |
Rv0131c fadE1 |
acyl-CoA dehydrogenase FadE1 | 851 | 844 | database:750 |
Rv0154c fadE2 |
acyl-CoA dehydrogenase FadE2 | 851 | 844 | database:750 |
Rv3140 fadE23 |
acyl-CoA dehydrogenase FadE23 | 849 | 844 | database:750 |
Rv0231 fadE4 |
acyl-CoA dehydrogenase FadE4 | 849 | 844 | database:750 |
Rv1715 fadB3 |
3-hydroxybutyryl-CoA dehydrogenase FadB | 937 | 820 | database:650 textmining:668 |
Rv1627c |
nonspecific lipid-transfer protein | 816 | 808 | database:447 |
Rv2790c ltp1 |
lipid-transfer protein | 809 | 801 | database:447 |
Rv0914c |
lipid carrier protein or keto acyl-CoA thiolase | 800 | 792 | database:447 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): enoyl-CoA hydratase EchA5
- Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=5e-42), ECH_2 PF16113.11 (E=4e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177745.1)
- Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1024 - Curated reference: UniProt I6Y4E8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
142 functional partner(s); context anchor
fadE8 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0675|echA5 MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTFCAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVPKGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGARRFAAGAGRHGAPAPRAEQGDTL