echA5 Resolved · high auto-curated

H37Rv Rv0675 · MTBC0 - · 263 aa · 774783–775574 (+) · RefSeq YP_177745.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)enoyl-CoA hydratase EchA5
MTBC0 PGAP re-annotation
Revised (this work)Enoyl-CoA hydratase EchA5. Pfam: ECH_1 (PF00378.26), ECH_2 (PF16113.11).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6Y4E8 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable enoyl-CoA hydratase EchA5
Curated functionCould possibly oxidize fatty acids using specific components.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameechA5
eggNOG descriptionBelongs to the enoyl-CoA hydratase isomerase family
Orthologous groupCOG1024
EC number EC 4.2.1.17
KEGG orthology K01692
KEGG pathways map00071, map00280, map00281, map00310, map00360, map00362, map00380, map00410, map00627, map00640, map00650, map00903, map00930, map01100, map01110, map01120, map01130, map01212
KEGG modules M00032, M00087

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.124 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (246) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ECH_1PF00378.26 5.5e-429–205 Enoyl-CoA hydratase/isomerase
ECH_2PF16113.11 4.3e-1914–196 Enoyl-CoA hydratase/isomerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadE8 (acyl-CoA dehydrogenase FadE8), high confidence from genomic context alone (score 958 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0672 fadE8 acyl-CoA dehydrogenase FadE8 959 958 ctx neighborhood:874 coexpression:487
Rv0673 echA4 enoyl-CoA hydratase EchA4 931 931 ctx neighborhood:881
Rv0674 hyp hypothetical protein 886 882 ctx neighborhood:881
Rv0468 fadB2 3-hydroxybutyryl-CoA dehydrogenase 861 856 database:650
Rv0400c fadE7 acyl-CoA dehydrogenase FadE7 853 846 database:750
Rv0975c fadE13 acyl-CoA dehydrogenase FadE13 852 845 database:750
Rv2500c fadE19 acyl-CoA dehydrogenase FadE19 852 845 database:750
Rv0131c fadE1 acyl-CoA dehydrogenase FadE1 851 844 database:750
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 851 844 database:750
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 849 844 database:750
Rv0231 fadE4 acyl-CoA dehydrogenase FadE4 849 844 database:750
Rv1715 fadB3 3-hydroxybutyryl-CoA dehydrogenase FadB 937 820 database:650 textmining:668
Rv1627c nonspecific lipid-transfer protein 816 808 database:447
Rv2790c ltp1 lipid-transfer protein 809 801 database:447
Rv0914c lipid carrier protein or keto acyl-CoA thiolase 800 792 database:447

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): enoyl-CoA hydratase EchA5
  • Pfam (hmmscan --cut_ga): ECH_1 PF00378.26 (E=5e-42), ECH_2 PF16113.11 (E=4e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177745.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ECH_1 (PF00378.26), ECH_2 (PF16113.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1024
  • Curated reference: UniProt I6Y4E8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 142 functional partner(s); context anchor fadE8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0675|echA5
MSDLVRVERKGRVTTVILNRPASRNAVNGPTAAALCAAFEQFDRDDAASVAVLWGAGGTFCAGADLKAFGTPEANSVHRTGPGPMGPSRMMLSKPVIAAVSGYAVAGGLELALWCDLRVAEEDAVFGVFCRRWGVPLIDGGTVRLPRLIGHSRAMDMILTGRGVPADEALAMGLANRVVPKGQARQAAEELAAQLAALPQQCLRSDRLSALHQWGLPESAALDLEFASIARVAGEALEGARRFAAGAGRHGAPAPRAEQGDTL