vapC5 Family assigned · medium auto-curated
H37Rv Rv0627 · MTBC0 mtbc0_000660 ·
135 aa ·
721835–722242 MTBC0
(+) ·
RefSeq NP_215141.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ribonuclease VapC5 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system VapC family toxin |
| Revised (this work) | Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) studied as much outside M. tuberculosis
The biology of this gene is documented at least as much outside M. tuberculosis as within it — 3 paper(s) in a non-TB mycobacterial context (M. abscessus 3) versus 1 in a TB context. Mycobacterial genetics is largely done in M. smegmatis, so part of what is “known” about this gene is known by proxy.
- Structural basis of the VapBC5 complex from Mycobacterium abscessus and its role in regulating persister cell formation. (2026)
- Potential Inhibitors of Mycobacterium abscessus VapC5 Protein: A Molecular Dynamics Simulation Study. (2026)
- Mycobacterium abscessus VapC5 toxin potentiates evasion of antibiotic killing by ribosome overproduction and activation of multiple resistance pathways. (2023)
Caveat: IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge.
3 TB publications mention this gene. 3 publication(s) discuss this gene. **Its biology is documented at least as much OUTSIDE M. tuberculosis as within it** (3 papers in a non-TB mycobacterial context — M. abscessus (3) — vs 1 in a TB context). Mycobacterial genetics is largely done in M. smegmatis, so part of what is 'known' about this gene is known by proxy.
| Publication | Date |
|---|---|
| Structural basis of the VapBC5 complex from Mycobacterium abscessus and its role in regulating persister cell formation. doi:10.1016/j.ijbiomac.2026.150860 | 2026 |
| Potential Inhibitors of Mycobacterium abscessus VapC5 Protein: A Molecular Dynamics Simulation Study. doi:10.2174/0115734099422413251124101238 | 2026 |
| Mycobacterium abscessus VapC5 toxin potentiates evasion of antibiotic killing by ribosome overproduction and activation of multiple resistance pathways. doi:10.1038/s41467-023-38844-4 | 2023 |
| Structure and proposed activity of a member of the VapBC family of toxin-antitoxin systems. VapBC-5 from Mycobacterium tuberculosis. doi:10.1074/jbc.M805061200 | 2009 |
IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv0626 (Rv0626, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.17 (95% CI -0.59 to 1.20). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0643
· 99.3% identity |
|---|---|
| M. orygis |
RJtmp_000658
· 99.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P96917
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Ribonuclease VapC5 |
| EC (curated) |
EC 3.1.-.-
|
| Curated function | Probable toxic component of a type II toxin-antitoxin (TA) system. The cognate antitoxin is VapB5. Has limited RNase activity on substrates; activity is seen with a VapC5-VapB5 complex. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | galT |
| eggNOG description | galactose-1-phosphate uridylyltransferase |
| Orthologous group | COG1085 |
| EC number |
EC 2.7.7.12
|
| KEGG orthology |
K00965
|
| KEGG pathways |
map00052, map00520, map01100, map04917
|
| KEGG modules |
M00362, M00554, M00632
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.79% of strains (1147) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 24/53 (45%) · mean identity 53.2%
· 4/4 closest MTBAP relatives present in a subset of the genus (24/53 NTM; in 4 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | Uncertain · uncertain |
|---|---|
| What the call means | uncertain (short or TA-poor ORF): no call possible |
| TA sites (Himar1) | 1 in the ORF — 0 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 1 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 46.2 ppm · rank 1807/3519 (48.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 135 aa |
|---|---|
| Molecular weight | 14.4 kDa |
| Theoretical pI | 4.58 |
| GRAVY | 0.288 (hydrophobic) |
| Aliphatic index | 115.0 |
| Aromaticity | 0.03 |
| Instability index | 33.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PIN | PF01850.28 | 1.1e-17 | 9–125 | PIN domain |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
3dbo |
X-ray diffraction | 1.76 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3dbo-assembly1_B |
1.00 | 0.99 | 1.4e-21 sig | 3dbo-assembly1_B Crystal structure of a member of the VapBC family of toxin-antitoxin systems, VapBC-5, from Mycobacterium tuberculosis |
5ecw-assembly1_B |
1.00 | 0.81 | 3.9e-08 sig | 5ecw-assembly1_B Structure of the Shigella flexneri VapC mutant D7A |
3zvk-assembly1_B |
1.00 | 0.78 | 2.7e-08 sig | 3zvk-assembly1_B Crystal structure of VapBC2 from Rickettsia felis bound to a DNA fragment from their promoter |
5ecw-assembly1_A |
1.00 | 0.79 | 5.1e-08 sig | 5ecw-assembly1_A Structure of the Shigella flexneri VapC mutant D7A |
5ed0-assembly2_B |
1.00 | 0.79 | 9.4e-08 sig | 5ed0-assembly2_B Structure of the Shigella flexneri VapC mutant D7N |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | vapB5 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0628c (- strand, 71 bp gap) |
| Predicted operon |
vapB5 · vapC5
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: vapB5 (antitoxin VapB5), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0626 vapB5 exp |
antitoxin VapB5 | 999 | 1000 ctx | neighborhood:882 cooccurence:769 experimental:999 textmining:818 |
Rv0596c vapB4 exp |
antitoxin VapB4 | 805 | 797 | experimental:784 |
Rv3384c vapC46 |
ribonuclease VapC46 | 590 | 580 ctx | cooccurence:510 |
Rv0625c |
transmembrane protein | 581 | 580 ctx | neighborhood:579 |
Rv3408 vapC47 |
ribonuclease VapC47 | 622 | 548 ctx | cooccurence:540 |
Rv1871c hyp |
hypothetical protein | 500 | 500 ctx | cooccurence:496 |
Rv3385c vapB46 |
antitoxin VapB46 | 498 | 498 | |
Rv3407 vapB47 |
antitoxin VapB47 | 481 | 481 | |
Rv0300 vapB2 exp |
antitoxin VapB2 | 925 | 449 | experimental:412 textmining:870 |
Rv1560 vapB11 |
antitoxin VapB11 | 438 | 438 | |
Rv1952 vapB14 |
antitoxin VapB14 | 437 | 415 | |
Rv2601A vapB41 |
antitoxin VapB41 | 432 | 410 | |
Rv0065 vapC1 |
ribonuclease VapC1 | 666 | 321 | textmining:529 |
Rv0549c vapC3 |
ribonuclease VapC3 | 637 | 266 | textmining:526 |
Rv0582 vapC26 |
ribonuclease VapC26 | 646 | 252 | textmining:546 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ribonuclease VapC5
- MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
- Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=1e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215141.1)
- Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1085 - Curated reference: UniProt P96917 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
33 functional partner(s); context anchor
vapB5 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000660|Rv0627|vapC5 MSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAARMWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for vapC5? Email the maintainer — the message is pre-filled with this gene's details.