vapB11 Resolved · high auto-curated

H37Rv Rv1560 · MTBC0 - · 72 aa · 1764755–1764973 (+) · RefSeq NP_216076.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB11
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB11. Pfam: VapB_antitoxin (PF09957.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLU3 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB11
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli and M.smegmatis neutralizes the effect of cognate toxin VapC11.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionBacterial antitoxin of type II TA system, VapB
Orthologous groupCOG5450
Gene Ontology (45) GO:0006417, GO:0008150, GO:0009605, GO:0009607, GO:0009889, GO:0009891, GO:0009893, GO:0010468, GO:0010556, GO:0010557, GO:0010604, GO:0010608 +33 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapB_antitoxinPF09957.16 1.6e-187–49 Bacterial antitoxin of type II TA system, VapB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC11 (ribonuclease VapC11), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1561 vapC11 ribonuclease VapC11 999 1000 ctx neighborhood:882 cooccurence:703 coexpression:817 experimental:999
Rv2010 vapC15 ribonuclease VapC15 961 961 ctx cooccurence:706 experimental:853
Rv1151c cobB NAD-dependent protein deacylase 765 765 coexpression:765
Rv1395 HTH-type transcriptional regulator 733 733 coexpression:733
Rv1960c parD1 antitoxin ParD1 733 733 coexpression:732
Rv3263 DNA methylase 732 732 coexpression:732
Rv0273c transcriptional regulator 731 731 coexpression:731
Rv0624 vapC30 ribonuclease VapC30 685 686 ctx cooccurence:509
Rv1559 ilvA threonine dehydratase IlvA 667 667 ctx neighborhood:659
Rv0158 transcriptional regulator 651 651 coexpression:651
Rv2759c vapC42 ribonuclease VapC42 623 624 ctx cooccurence:529
Rv3488 hyp hypothetical protein 615 615 coexpression:615
Rv0603 hyp hypothetical protein 580 580 coexpression:580
Rv1558 hyp hypothetical protein 566 565 ctx neighborhood:563
Rv1557 mmpL6 transmembrane transport protein MmpL6 561 561 ctx neighborhood:556

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB11
  • Pfam (hmmscan --cut_ga): VapB_antitoxin PF09957.16 (E=2e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216076.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapB_antitoxin (PF09957.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5450
  • Curated reference: UniProt P9WLU3 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor vapC11
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1560|vapB11
MYRWCMSRTNIDIDDELAAEVMRRFGLTTKRAAVDLALRRLVGSPLSREFLLGLEGVGWEGDLDDLRSDRPD