vapB8 Resolved · medium auto-curated

H37Rv Rv0664 · MTBC0 - · 90 aa · 758532–758804 (+) · RefSeq NP_215178.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB8
MTBC0 PGAP re-annotation
Revised (this work)Antitoxin VapB8.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06775 SwissProt · reviewed · Predicted
UniProt namePutative antitoxin VapB8
Curated functionAntitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC8.

UniProt still lists this protein as Putative antitoxin VapB8; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.37 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC8 (ribonuclease VapC8), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0665 vapC8 ribonuclease VapC8 888 888 ctx neighborhood:882
Rv0666 membrane protein 787 788 ctx neighborhood:781
Rv0663 atsD arylsulfatase AtsD 707 708 ctx neighborhood:700
Rv0662c vapB7 antitoxin VapB7 475 476 ctx neighborhood:473
Rv0661c vapC7 ribonuclease VapC7 736 474 ctx neighborhood:473 textmining:520
Rv1440 secG protein-export membrane protein SecG 444 50 textmining:439
Rv2760c vapB42 antitoxin VapB42 624 44 textmining:623
Rv0581 vapB26 antitoxin VapB26 544 41 textmining:544
Rv3155 nuoK NADH-quinone oxidoreductase subunit K 510 41 textmining:510
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 432 41 textmining:432
Rv1458c antibiotic ABC transporter ATP-binding protein 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): antitoxin VapB8
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215178.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O06775 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor vapC8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0664|vapB8
MEKSRCHAVAHGGGCAGSAKSHKSGGRCGQGRGAGDSHGTRGAGRRYRAASAPHPLAVGAHLRDELAKRSADPRLTDELNDLAGHTLDDL