Rv0539 Resolved · high auto-curated

H37Rv Rv0539 · MTBC0 - · 210 aa · 631743–632375 (+) · RefSeq NP_215053.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dolichyl-phosphate sugar synthase
MTBC0 PGAP re-annotation
Revised (this work)Dolichyl-phosphate sugar synthase. Pfam: Glycos_transf_2 (PF00535.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WMY1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized glycosyltransferase Rv0539
EC (curated) EC 2.4.-.-

UniProt still lists this protein as Uncharacterized glycosyltransferase Rv0539; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionPFAM Glycosyl transferase family 2
Orthologous groupCOG1215

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.13 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Glycos_transf_2PF00535.33 5.7e-202–147 Glycosyl transferase family 2

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0218 (transmembrane protein), high confidence from genomic context alone (score 877 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0540 hyp hypothetical protein 997 985 ctx neighborhood:882 fusion:499 cooccurence:766 textmining:870
Rv0218 transmembrane protein 877 877 ctx neighborhood:521 cooccurence:753
Rv0536 galE3 UDP-glucose 4-epimerase GalE 978 835 ctx cooccurence:771 textmining:874
Rv0538 membrane protein 810 810 ctx neighborhood:804
Rv0541c integral membrane protein 971 793 ctx cooccurence:741 textmining:870
Rv0535 pnp 5'-methylthioadenosine phosphorylase 936 533 ctx cooccurence:416 textmining:870
Rv0219 transmembrane protein 507 507 ctx cooccurence:443
Rv3631 transferase 911 346 textmining:870
Rv0091 mtn 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 810 53 textmining:808
Rv2855 mtr mycothione reductase 660 41 textmining:661

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): dolichyl-phosphate sugar synthase
  • Pfam (hmmscan --cut_ga): Glycos_transf_2 PF00535.33 (E=6e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215053.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glycos_transf_2 (PF00535.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1215
  • Curated reference: UniProt P9WMY1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv0218
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0539|
MLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTATVAARHGAQVVVEPRPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGADLVTGRRRPVAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDLGVVDRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSIIAILDFWKVIS