acyP Resolved · high auto-curated

H37Rv Rv2922A · MTBC0 - · 93 aa · 3237818–3238099 (-) · RefSeq YP_177679.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acylphosphatase
MTBC0 PGAP re-annotation
Revised (this work)Acylphosphatase. Pfam: Acylphosphatase (PF00708.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameacyP
eggNOG descriptionacylphosphatase
Orthologous groupCOG1254
EC number EC 3.6.1.7
KEGG orthology K01512
KEGG pathways map00620, map00627, map01120
Gene Ontology (6) GO:0003674, GO:0003824, GO:0003998, GO:0016787, GO:0016817, GO:0016818

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AcylphosphatasePF00708.25 3.1e-2510–91 Acylphosphatase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: smc (chromosome partition protein Smc), high confidence from genomic context alone (score 877 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0408 pta phosphate acetyltransferase 922 911 database:900
Rv3175 amidase 903 904 database:900
Rv1263 amiB2 amidase AmiB 903 904 database:900
Rv2363 amiA2 amidase 903 904 database:900
Rv3375 amiD amidase 903 904 database:900
Rv2888c amiC amidase AmiC 903 904 database:900
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 908 903 database:900
Rv0458 aldehyde dehydrogenase 907 903 database:900
Rv0147 aldehyde dehydrogenase 906 902 database:900
Rv0223c aldehyde dehydrogenase 906 902 database:900
Rv0768 aldA aldehyde dehydrogenase AldA 906 902 database:900
Rv3667 acs acetyl-CoAsynthetase 905 901 database:900
Rv0409 ackA acetate kinase 912 900 database:900
Rv2923c hyp hypothetical protein 883 883 ctx neighborhood:882
Rv2922c smc chromosome partition protein Smc 933 877 ctx neighborhood:876 textmining:479

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acylphosphatase
  • Pfam (hmmscan --cut_ga): Acylphosphatase PF00708.25 (E=3e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177679.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acylphosphatase (PF00708.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1254
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor smc
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2922A|acyP
MSAPDVRLTAWVHGWVQGVGFRWWTRCRALELGLTGYAANHADGRVLVVAQGPRAACQKLLQLLQGDTTPGRVAKVVADWSQSTEQITGFSER