acyP Resolved · high auto-curated
H37Rv Rv2922A · MTBC0 - ·
93 aa · 3237818–3238099 (-) ·
RefSeq YP_177679.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acylphosphatase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Acylphosphatase. Pfam: Acylphosphatase (PF00708.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | acyP |
| eggNOG description | acylphosphatase |
| Orthologous group | COG1254 |
| EC number |
EC 3.6.1.7
|
| KEGG orthology |
K01512
|
| KEGG pathways |
map00620, map00627, map01120
|
| Gene Ontology (6) |
GO:0003674, GO:0003824, GO:0003998, GO:0016787, GO:0016817, GO:0016818
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acylphosphatase | PF00708.25 | 3.1e-25 | 10–91 | Acylphosphatase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: smc (chromosome partition protein Smc), high confidence from genomic context alone (score 877 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0408 pta |
phosphate acetyltransferase | 922 | 911 | database:900 |
Rv3175 |
amidase | 903 | 904 | database:900 |
Rv1263 amiB2 |
amidase AmiB | 903 | 904 | database:900 |
Rv2363 amiA2 |
amidase | 903 | 904 | database:900 |
Rv3375 amiD |
amidase | 903 | 904 | database:900 |
Rv2888c amiC |
amidase AmiC | 903 | 904 | database:900 |
Rv3293 pcd |
piperideine-6-carboxylic acid dehydrogenase | 908 | 903 | database:900 |
Rv0458 |
aldehyde dehydrogenase | 907 | 903 | database:900 |
Rv0147 |
aldehyde dehydrogenase | 906 | 902 | database:900 |
Rv0223c |
aldehyde dehydrogenase | 906 | 902 | database:900 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 906 | 902 | database:900 |
Rv3667 acs |
acetyl-CoAsynthetase | 905 | 901 | database:900 |
Rv0409 ackA |
acetate kinase | 912 | 900 | database:900 |
Rv2923c hyp |
hypothetical protein | 883 | 883 ctx | neighborhood:882 |
Rv2922c smc |
chromosome partition protein Smc | 933 | 877 ctx | neighborhood:876 textmining:479 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acylphosphatase
- Pfam (hmmscan --cut_ga): Acylphosphatase PF00708.25 (E=3e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177679.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acylphosphatase (PF00708.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1254 - Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
23 functional partner(s); context anchor
smc - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2922A|acyP MSAPDVRLTAWVHGWVQGVGFRWWTRCRALELGLTGYAANHADGRVLVVAQGPRAACQKLLQLLQGDTTPGRVAKVVADWSQSTEQITGFSER