Rv0367c Family assigned · medium auto-curated
H37Rv Rv0367c · MTBC0 mtbc0_000387 ·
129 aa · 448206–448595 (-) ·
RefSeq NP_214881.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Contains ParD_like (PF11903.15) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53702
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | ParD-like antitoxin of type II toxin-antitoxin system |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | ParD-like antitoxin of type II bacterial toxin-antitoxin system |
| Orthologous group | 2DSFE |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.372 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ParD_like | PF11903.15 | 3.8e-18 | 7–104 | ParD-like antitoxin of type II bacterial toxin-antitoxin system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0369c (membrane oxidoreductase), medium confidence from genomic context alone (score 608 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0366c hyp |
hypothetical protein | 984 | 847 ctx | neighborhood:843 textmining:902 |
Rv0365c hyp |
hypothetical protein | 955 | 674 ctx | neighborhood:670 textmining:870 |
Rv0368c hyp |
hypothetical protein | 947 | 611 ctx | neighborhood:606 textmining:870 |
Rv0369c |
membrane oxidoreductase | 609 | 608 ctx | neighborhood:606 |
Rv0372c hyp |
hypothetical protein | 432 | 432 ctx | neighborhood:427 |
Rv0370c |
oxidoreductase | 429 | 429 ctx | neighborhood:427 |
Rv0371c hyp |
hypothetical protein | 427 | 428 ctx | neighborhood:427 |
Rv0373c |
carbon monoxyde dehydrogenase large subunit | 410 | 411 ctx | neighborhood:409 |
Rv0374c |
carbon monoxyde dehydrogenase small subunit | 409 | 409 ctx | neighborhood:409 |
Rv0375c |
carbon monoxyde dehydrogenase medium subunit | 403 | 403 | |
Rv0268c hyp |
hypothetical protein | 804 | 47 | textmining:803 |
Rv0078A hyp |
hypothetical protein | 648 | 47 | textmining:646 |
Rv0208c trmB |
tRNA (guanine-N(7)-)-methyltransferase | 630 | 45 | textmining:629 |
Rv0269c hyp |
hypothetical protein | 803 | 44 | textmining:803 |
Rv2017 |
transcriptional regulator | 515 | 44 | textmining:514 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): ParD_like PF11903.15 (E=4e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214881.1)
- Domains: Pfam-A via hmmscan --cut_ga — ParD_like (PF11903.15)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DSFE - Curated reference: UniProt O53702 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
Rv0369c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000387|Rv0367c| MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVSNQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITTVALNDAGDIVEHRPDGTSVVLAATP