Rv0157A Still unknown · low auto-curated
H37Rv Rv0157A · MTBC0 - ·
42 aa · 186495–186623 (-) ·
RefSeq YP_007408797.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 8w9z-assembly1_F The cryo-EM structure of the Nicotiana tabacum PEP-PA (prob 0.09, TM 0.77). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6WXK8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Cysteine-rich secretory protein family |
| Orthologous group | COG2340 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 60.6 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8w9z-assembly1_F |
0.09 | 0.77 | 9.9e+00 | 8w9z-assembly1_F The cryo-EM structure of the Nicotiana tabacum PEP-PAP |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0158 (transcriptional regulator), medium confidence from genomic context alone (score 558 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0158 |
transcriptional regulator | 558 | 558 ctx | neighborhood:558 |
Rv1200 |
integral membrane transport protein | 548 | 541 | database:487 |
Rv1972 |
Mce associated membrane protein | 483 | 459 | |
Rv1950c hyp |
hypothetical protein | 441 | 441 | coexpression:431 |
Rv0756c hyp |
hypothetical protein | 439 | 440 | coexpression:430 |
Rv3881c espB |
ESX-1 secretion-associated protein EspB | 438 | 439 | coexpression:429 |
Rv0909 |
antitoxin | 438 | 438 | coexpression:428 |
Rv3903c cpnT hyp |
hypothetical protein | 438 | 438 | coexpression:428 |
Rv1305 atpE |
ATP synthase subunit C | 430 | 430 | database:418 |
Rv1362c |
membrane protein | 435 | 410 | |
Rv1973 |
Mce associated membrane protein | 435 | 410 | |
Rv3492c |
Mce associated protein | 418 | 392 | |
Rv1363c |
membrane protein | 417 | 391 | |
Rv2390c hyp |
hypothetical protein | 416 | 390 | |
Rv0200 |
transmembrane protein | 416 | 390 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Foldseek best: 8w9z-assembly1_F The cryo-EM structure of the Nicotiana tabacum PEP-PAP (prob 0.09, E=1e+01, TM=0.77)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007408797.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2340 - Curated reference: UniProt I6WXK8 (TrEMBL, unreviewed; Evidence at protein level)
- Model confidence: ESMFold per-residue pLDDT (mean 60.6, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
Rv0158 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0157A| MMDPSPDYDVSDEIEFFFRYLTWGLRGVETGDGYPPPAYPPV