Rv2277c Resolved · high auto-curated
H37Rv Rv2277c · MTBC0 - ·
301 aa ·
2549124–2550029 H37Rv
(-) ·
RefSeq NP_216793.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glycerolphosphodiesterase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Glycerolphosphodiesterase. Pfam: GDPD (PF03009.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.34 (95% CI -5.61 to 7.82). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2300c
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_4162
· 72.7% identity |
| M. orygis |
RJtmp_002353
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WLF1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2277c |
UniProt still lists this protein as Uncharacterized protein Rv2277c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | gdpD |
| eggNOG description | hydrolyses glycerophosphodiesters such as glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol) |
| Orthologous group | COG0584 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.017 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 6/53 (11%) · mean identity 70.5%
· 1/4 closest MTBAP relatives present in a subset of the genus (6/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 32.3% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 0.846, mean read count 32.5454545455. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 30.8 ppm · rank 2054/3519 (41.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) signal peptide
| Prediction | predicted secreted protein (signal peptide) |
|---|---|
| DeepTMHMM class | SP |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 301 aa |
|---|---|
| Molecular weight | 32.2 kDa |
| Theoretical pI | 5.19 |
| GRAVY | -0.096 (hydrophilic) |
| Aliphatic index | 86.2 |
| Aromaticity | 0.06 |
| Instability index | 30.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
GDPD | PF03009.24 | 1.3e-20 | 36–293 | Glycerophosphoryl diester phosphodiesterase family |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5vug |
X-ray diffraction | 1.5 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5vug-assembly1_A-2 |
1.00 | 1.00 | 2.5e-56 sig | 5vug-assembly1_A-2 Crystal Structure of Glycerophosphoryl Diester Phosphodiesterase Domain of Uncharacterized Protein Rv2277c from Mycobacterium tuberculosis |
8ghi-assembly1_A |
1.00 | 0.80 | 4.2e-19 sig | 8ghi-assembly1_A Crystal structure of Staphylococcus aureus Lysophosphatidylglycerol phospholipase D |
2pz0-assembly1_A |
1.00 | 0.84 | 3.1e-15 sig | 2pz0-assembly1_A Crystal structure of Glycerophosphodiester Phosphodiesterase (GDPD) from T. tengcongensis |
1zcc-assembly1_D |
1.00 | 0.81 | 2.1e-14 sig | 1zcc-assembly1_D Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens str.C58 |
5t9b-assembly1_G |
1.00 | 0.73 | 3.3e-15 sig | 5t9b-assembly1_G Crystal structure of B. subtilis 168 GlpQ in complex with glycerol-3-phosphate (5 minute soak) |
Foldseek search of the AlphaFold DB model (mean pLDDT 92.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) fold only
| M-CSA entry | 300 · EC 3.1.4.46 |
|---|---|
| Catalytic residues | 3/8 identical (8/8 aligned) |
| Verdict | FOLD-ONLY (3/8 identical although 8/8 aligned: catalytic residues SUBSTITUTED) -> same fold, active site NOT retained |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | cyp121 (+ strand, 184 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2280 (+ strand, 1530 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: glpQ1 (glycerophosphoryl diester phosphodiesterase), high confidence from genomic context alone (score 953 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3842c glpQ1 exp |
glycerophosphoryl diester phosphodiesterase | 952 | 953 ctx | cooccurence:546 database:900 |
Rv0317c glpQ2 exp |
glycerophosphoryl diester phosphodiesterase GlpQ | 943 | 943 ctx | cooccurence:455 database:900 |
Rv2249c glpD1 exp |
glycerol-3-phosphate dehydrogenase | 696 | 677 | database:500 |
Rv3302c glpD2 exp |
glycerol-3-phosphate dehydrogenase | 696 | 677 | database:500 |
Rv2278 |
Rv2278, (MTCY339.32c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase s | 571 | 571 ctx | neighborhood:564 |
Rv2279 |
Probable transposase; Rv2279, (MTCY339.31c), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transp | 565 | 565 ctx | neighborhood:564 |
Rv3696c glpK |
glycerol kinase | 603 | 464 | coexpression:444 |
Rv2126c PE_PGRS37 |
PE-PGRS family protein PE_PGRS37 | 451 | 451 ctx | cooccurence:451 |
Rv1243c PE_PGRS23 |
PE-PGRS family protein PE_PGRS23 | 422 | 422 ctx | cooccurence:422 |
Rv0178 exp |
Mce associated membrane protein | 490 | 409 | database:401 |
Rv1972 exp |
Mce associated membrane protein | 428 | 408 | database:401 |
Rv1973 exp |
Mce associated membrane protein | 428 | 407 | database:401 |
Rv0200 exp |
transmembrane protein | 427 | 407 | database:401 |
Rv1363c exp |
membrane protein | 425 | 405 | database:401 |
Rv3492c exp |
Mce associated protein | 558 | 404 | database:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): glycerolphosphodiesterase
- Pfam (hmmscan --cut_ga): GDPD PF03009.24 (E=1e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216793.1)
- Domains: Pfam-A via hmmscan --cut_ga — GDPD (PF03009.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0584 - Curated reference: UniProt P9WLF1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.6)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 300; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
27 functional partner(s); context anchor
glpQ1 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2277c| MPGRFTVALVIALGGTCGVADALPLGQTDDPMIVAHRAGTRDFPENTVLAITNAVAAGVDGMWLTVQVSSDGVPVLYRPSDLATLTDGAGPVNSKTVQQLQQLNAGWNFTTPGVEGHPYRQRATPIPTLEQAIGATPPDMTLFLDLKQTPPQPLVSAVAQVLTRTGAAGRSIVYSTNADITAAASRQEGLQVAESRDVTRQRLFNMALNHHCDPQPDPGKWAGFELHRDVTVTEEFTLGSGISAVNAELWDEASVDCFRSQSGMKVMGFAVKTVDDYRLAHKIGLDAVLVDSPLAAQQWRH
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2277c? Email the maintainer — the message is pre-filled with this gene's details.