Rv2277c Resolved · high auto-curated

H37Rv Rv2277c · MTBC0 - · 301 aa · 2549124–2550029 (-) · RefSeq NP_216793.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycerolphosphodiesterase
MTBC0 PGAP re-annotation
Revised (this work)Glycerolphosphodiesterase. Pfam: GDPD (PF03009.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLF1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2277c

UniProt still lists this protein as Uncharacterized protein Rv2277c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namegdpD
eggNOG descriptionhydrolyses glycerophosphodiesters such as glycerophosphocholine, glycerophosphoethanolamine, glycerophosphoglycerol, and bis(glycerophosphoglycerol)
Orthologous groupCOG0584

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.017 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GDPDPF03009.24 1.3e-2036–293 Glycerophosphoryl diester phosphodiesterase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: glpQ1 (glycerophosphoryl diester phosphodiesterase), high confidence from genomic context alone (score 953 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3842c glpQ1 glycerophosphoryl diester phosphodiesterase 952 953 ctx cooccurence:546 database:900
Rv0317c glpQ2 glycerophosphoryl diester phosphodiesterase GlpQ 943 943 ctx cooccurence:455 database:900
Rv2249c glpD1 glycerol-3-phosphate dehydrogenase 696 677 database:500
Rv3302c glpD2 glycerol-3-phosphate dehydrogenase 696 677 database:500
Rv2278 Rv2278, (MTCY339.32c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase s 571 571 ctx neighborhood:564
Rv2279 Probable transposase; Rv2279, (MTCY339.31c), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transp 565 565 ctx neighborhood:564
Rv3696c glpK glycerol kinase 603 464 coexpression:444
Rv2126c PE_PGRS37 PE-PGRS family protein PE_PGRS37 451 451 ctx cooccurence:451
Rv1243c PE_PGRS23 PE-PGRS family protein PE_PGRS23 422 422 ctx cooccurence:422
Rv0178 Mce associated membrane protein 490 409 database:401
Rv1972 Mce associated membrane protein 428 408 database:401
Rv1973 Mce associated membrane protein 428 407 database:401
Rv0200 transmembrane protein 427 407 database:401
Rv1363c membrane protein 425 405 database:401
Rv3492c Mce associated protein 558 404 database:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): glycerolphosphodiesterase
  • Pfam (hmmscan --cut_ga): GDPD PF03009.24 (E=1e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216793.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GDPD (PF03009.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0584
  • Curated reference: UniProt P9WLF1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor glpQ1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2277c|
MPGRFTVALVIALGGTCGVADALPLGQTDDPMIVAHRAGTRDFPENTVLAITNAVAAGVDGMWLTVQVSSDGVPVLYRPSDLATLTDGAGPVNSKTVQQLQQLNAGWNFTTPGVEGHPYRQRATPIPTLEQAIGATPPDMTLFLDLKQTPPQPLVSAVAQVLTRTGAAGRSIVYSTNADITAAASRQEGLQVAESRDVTRQRLFNMALNHHCDPQPDPGKWAGFELHRDVTVTEEFTLGSGISAVNAELWDEASVDCFRSQSGMKVMGFAVKTVDDYRLAHKIGLDAVLVDSPLAAQQWRH