Rv1414 Family assigned · medium auto-curated
H37Rv Rv1414 · MTBC0 - ·
133 aa · 1589891–1590292 (+) ·
RefSeq NP_215930.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains D-ser_dehydrat (PF14031.14) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WLY3
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv1414 |
UniProt still lists this protein as Uncharacterized protein Rv1414; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| eggNOG description | Alanine racemase |
| Orthologous group | COG3616 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.089 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
D-ser_dehydrat | PF14031.14 | 1.8e-21 | 19–115 | Putative serine dehydratase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ribH (6,7-dimethyl-8-ribityllumazine synthase), medium confidence from genomic context alone (score 564 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1413 hyp |
hypothetical protein | 997 | 997 ctx | neighborhood:882 fusion:899 cooccurence:774 |
Rv3470c ilvB2 |
acetolactate synthase large subunit | 683 | 683 | coexpression:658 |
Rv1416 ribH |
6,7-dimethyl-8-ribityllumazine synthase | 564 | 564 ctx | neighborhood:561 |
Rv1417 |
membrane protein | 540 | 540 ctx | neighborhood:535 |
Rv1415 ribA2 |
bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase | 537 | 536 ctx | neighborhood:535 |
Rv1418 lprH |
lipoprotein LprH | 478 | 478 ctx | neighborhood:475 |
Rv1412 ribC |
riboflavin synthase | 471 | 471 ctx | neighborhood:468 |
Rv2004c hyp |
hypothetical protein | 414 | 414 | coexpression:414 |
Rv2308 hyp |
hypothetical protein | 888 | 180 | textmining:870 |
Rv3391 acrA1 |
acyl-CoA-reductase AcrA | 886 | 163 | textmining:870 |
Rv3445c esxU |
ESAT-6 like protein EsxU | 805 | 51 | textmining:803 |
Rv0547c |
oxidoreductase | 870 | 44 | textmining:870 |
Rv3234c tgs3 |
diacyglycerol O-acyltransferase | 803 | 44 | textmining:803 |
Rv3723 lucA |
transmembrane protein | 860 | 41 | textmining:860 |
Rv2219 |
transmembrane protein | 803 | 41 | textmining:803 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): D-ser_dehydrat PF14031.14 (E=2e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215930.1)
- Domains: Pfam-A via hmmscan --cut_ga — D-ser_dehydrat (PF14031.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3616 - Curated reference: UniProt P9WLY3 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
ribH - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1414| MLGDAQQLELGRCAPADIALTVAATVVSRQDCRSGLRRIVLDCGSKILGSDRPAWATGFGRLIDHADARIAALSEHHATVVWPDDAPLPPVGTRLRVIPNHVCLTTNLVDDVAVVRDATLIDRWKVAARGKNH