Rv3136A Still unknown · low auto-curated

H37Rv Rv3136A · MTBC0 - · 110 aa · 3502945–3503277 (-) · RefSeq YP_007411850.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7d8r-assembly2_C MITF HLHLZ structure (prob 0.41, TM 0.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6Y2Q7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B18P

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 69.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7d8r-assembly2_C 0.41 0.32 2.7e-01 7d8r-assembly2_C MITF HLHLZ structure
7d8r-assembly2_D 0.33 0.33 4.9e-01 7d8r-assembly2_D MITF HLHLZ structure
7d8r-assembly1_A 0.28 0.33 6.1e-01 7d8r-assembly1_A MITF HLHLZ structure
8th5-assembly1_A 0.16 0.69 7.2e+00 8th5-assembly1_A Crystal Structure of the G3BP1 NTF2-like domain bound to the IDR1 of SARS-CoV-2 nucleocapsid protein P13L mutant
3rd4-assembly2_A 0.15 0.39 1.6e+00 3rd4-assembly2_A Crystal structure of PROPEN_03304 from Proteus penneri ATCC 35198 Northeast Structural Genomics Consortium target id PvR55
8d0k-assembly1_A 0.15 0.35 1.1e+00 8d0k-assembly1_A Human CST-DNA polymerase alpha/primase preinitiation complex bound to 4xTEL-foldback template - PRIM2C advanced PIC
6yam-assembly1_j 0.14 0.37 1.6e+00 6yam-assembly1_j Mammalian 48S late-stage translation initiation complex (LS48S+eIF3 IC) with beta-globin mRNA
7ypo-assembly1_A 0.11 0.38 2.9e+00 7ypo-assembly1_A Cryo-EM structure of baculovirus LEF-3 in complex with ssDNA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hisN (histidinol-phosphatase), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3137 hisN histidinol-phosphatase 778 778 ctx neighborhood:778
Rv3138 pflA pyruvate formate lyase activating protein PflA 748 749 ctx neighborhood:749
Rv3140 fadE23 acyl-CoA dehydrogenase FadE23 691 691 ctx neighborhood:691
Rv3139 fadE24 acyl-CoA dehydrogenase 495 495 ctx neighborhood:495

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 7d8r-assembly2_C MITF HLHLZ structure (prob 0.41, E=3e-01, TM=0.32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007411850.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B18P
  • Curated reference: UniProt I6Y2Q7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 69.7, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor hisN
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3136A|
MGWEFGVLLILIAVLAVFLAPRLIPRGPRGDLASGTLLVTGVSPRPDAGGQQYVTIAGIITGPTVNEYAVYQRMAVDVDQWPTVGQILPVVYSPKNPDNWTFTPNGPPVG