mutT1 Resolved · high auto-curated

H37Rv Rv2985 · MTBC0 mtbc0_003170 · 317 aa · 3363474–3364427 (+) · RefSeq NP_217501.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)8-oxo-dGTP diphosphatase
MTBC0 PGAP re-annotationNUDIX hydrolase
Revised (this work)NUDIX hydrolase. Pfam: NUDIX (PF00293.35), His_Phos_1 (PF00300.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIY3 SwissProt · reviewed · Evidence at protein level
UniProt name8-oxo-(d)GTP phosphatase
EC (curated) EC 3.6.1.69
Curated functionCatalyzes the conversion of 8-oxo-dGTP to 8-oxo-dGDP, and 8-oxo-GTP to 8-oxo-GDP. Functions in concert with Rv1700 to detoxify 8-oxo-dGTP to 8-oxo-dGMP and plays an important role in supporting cellular growth under oxidative stress.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
L Replication, recombination and repair
Preferred namemutT
eggNOG descriptionBelongs to the NUDIX hydrolase family
Orthologous groupCOG0406
EC number EC 3.6.1.55
KEGG orthology K03574

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.066 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NUDIXPF00293.35 7.7e-1735–146 NUDIX domain
His_Phos_1PF00300.28 1.5e-11157–236 Histidine phosphatase superfamily (branch 1)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ppk1 (polyphosphate kinase), high confidence from genomic context alone (score 818 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2984 ppk1 polyphosphate kinase 824 818 ctx neighborhood:783
Rv2983 cofC 2-phospho-L-lactate guanylyltransferase 653 654 ctx neighborhood:654
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 658 638 ctx neighborhood:526
Rv2982c gpdA2 glycerol-3-phosphate dehydrogenase 657 637 ctx neighborhood:620
Rv1700 NUDIX hydrolase 609 582 database:500
Rv2066 cobIJ bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase 545 521 coexpression:460
Rv2413c hyp hypothetical protein 523 505 ctx cooccurence:447
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 474 474 ctx cooccurence:464
Rv2708c hyp hypothetical protein 433 434 ctx cooccurence:432
Rv0255c cobQ1 cobyric acid synthase 456 430 coexpression:411
Rv2981c ddlA D-alanine--D-alanine ligase 425 425
Rv2421c nadD nicotinate-nucleotide adenylyltransferase 408 372
Rv1937 oxygenase 546 362
Rv3667 acs acetyl-CoAsynthetase 416 339
Rv0385 monooxygenase 415 330

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 8-oxo-dGTP diphosphatase
  • MTBC0 PGAP product: NUDIX hydrolase
  • Pfam (hmmscan --cut_ga): NUDIX PF00293.35 (E=8e-17), His_Phos_1 PF00300.28 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217501.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NUDIX (PF00293.35), His_Phos_1 (PF00300.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0406
  • Curated reference: UniProt P9WIY3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor ppk1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003170|Rv2985|mutT1
MSIQNSSARRRSAGRIVYAAGAVLWRPGSADSEGPVEIAVIHRPRYDDWSLPKGKVDPGETAPVGAVREILEETGHRANLGRRLLTVTYPTDSPFRGVKKVHYWAARSTGGEFTPGSEVDELIWLPVPDAMNKLDYAQDRKVLCRFAKHPADTQTVLVVRHGTAGSKAHFSGDDSKRPLDKRGRAQAEALVPQLLAFGATDVYAADRVRCHQTMEPLAAELNVTIHNEPTLTEESYANNPKRGRHRVLQIVEQVGTPVICTQGKVIPDLITWWCERDGVHPDKSRNRKGSTWVLSLSAGRLVTADHIGGALAANVRA