mutT1 Resolved · high auto-curated
H37Rv Rv2985 · MTBC0 mtbc0_003170 ·
317 aa · 3363474–3364427 (+) ·
RefSeq NP_217501.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 8-oxo-dGTP diphosphatase |
|---|---|
| MTBC0 PGAP re-annotation | NUDIX hydrolase |
| Revised (this work) | NUDIX hydrolase. Pfam: NUDIX (PF00293.35), His_Phos_1 (PF00300.28). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIY3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 8-oxo-(d)GTP phosphatase |
| EC (curated) |
EC 3.6.1.69
|
| Curated function | Catalyzes the conversion of 8-oxo-dGTP to 8-oxo-dGDP, and 8-oxo-GTP to 8-oxo-GDP. Functions in concert with Rv1700 to detoxify 8-oxo-dGTP to 8-oxo-dGMP and plays an important role in supporting cellular growth under oxidative stress. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolismL Replication, recombination and repair
|
|---|---|
| Preferred name | mutT |
| eggNOG description | Belongs to the NUDIX hydrolase family |
| Orthologous group | COG0406 |
| EC number |
EC 3.6.1.55
|
| KEGG orthology |
K03574
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.066 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
NUDIX | PF00293.35 | 7.7e-17 | 35–146 | NUDIX domain |
His_Phos_1 | PF00300.28 | 1.5e-11 | 157–236 | Histidine phosphatase superfamily (branch 1) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ppk1 (polyphosphate kinase), high confidence from genomic context alone (score 818 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2984 ppk1 |
polyphosphate kinase | 824 | 818 ctx | neighborhood:783 |
Rv2983 cofC |
2-phospho-L-lactate guanylyltransferase | 653 | 654 ctx | neighborhood:654 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 658 | 638 ctx | neighborhood:526 |
Rv2982c gpdA2 |
glycerol-3-phosphate dehydrogenase | 657 | 637 ctx | neighborhood:620 |
Rv1700 |
NUDIX hydrolase | 609 | 582 | database:500 |
Rv2066 cobIJ |
bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase | 545 | 521 | coexpression:460 |
Rv2413c hyp |
hypothetical protein | 523 | 505 ctx | cooccurence:447 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 474 | 474 ctx | cooccurence:464 |
Rv2708c hyp |
hypothetical protein | 433 | 434 ctx | cooccurence:432 |
Rv0255c cobQ1 |
cobyric acid synthase | 456 | 430 | coexpression:411 |
Rv2981c ddlA |
D-alanine--D-alanine ligase | 425 | 425 | |
Rv2421c nadD |
nicotinate-nucleotide adenylyltransferase | 408 | 372 | |
Rv1937 |
oxygenase | 546 | 362 | |
Rv3667 acs |
acetyl-CoAsynthetase | 416 | 339 | |
Rv0385 |
monooxygenase | 415 | 330 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 8-oxo-dGTP diphosphatase
- MTBC0 PGAP product: NUDIX hydrolase
- Pfam (hmmscan --cut_ga): NUDIX PF00293.35 (E=8e-17), His_Phos_1 PF00300.28 (E=1e-11)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217501.1)
- Domains: Pfam-A via hmmscan --cut_ga — NUDIX (PF00293.35), His_Phos_1 (PF00300.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0406 - Curated reference: UniProt P9WIY3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
ppk1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003170|Rv2985|mutT1 MSIQNSSARRRSAGRIVYAAGAVLWRPGSADSEGPVEIAVIHRPRYDDWSLPKGKVDPGETAPVGAVREILEETGHRANLGRRLLTVTYPTDSPFRGVKKVHYWAARSTGGEFTPGSEVDELIWLPVPDAMNKLDYAQDRKVLCRFAKHPADTQTVLVVRHGTAGSKAHFSGDDSKRPLDKRGRAQAEALVPQLLAFGATDVYAADRVRCHQTMEPLAAELNVTIHNEPTLTEESYANNPKRGRHRVLQIVEQVGTPVICTQGKVIPDLITWWCERDGVHPDKSRNRKGSTWVLSLSAGRLVTADHIGGALAANVRA