Rv2484c Family assigned · medium auto-curated
H37Rv Rv2484c · MTBC0 mtbc0_002644 ·
491 aa · 2813909–2815384 (-) ·
RefSeq NP_217000.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacyglycerol O-acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | wax ester/triacylglycerol synthase family O-acyltransferase |
| Revised (this work) | Wax ester/triacylglycerol synthase family O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKB3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative diacyglycerol O-acyltransferase Rv2484c |
| EC (curated) |
EC 2.3.1.20
|
| Curated function | Upon expression in E.coli functions very weakly as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Has no wax synthase activity. |
UniProt still lists this protein as Putative diacyglycerol O-acyltransferase Rv2484c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Belongs to the long-chain O-acyltransferase family |
| Orthologous group | COG1020 |
| EC number |
EC 2.3.1.20
|
| KEGG orthology |
K00635
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (60) |
GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.376 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 6 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WS_DGAT_cat | PF03007.22 | 2.4e-80 | 8–282 | Wax ester synthase/diacylglycerol acyltransferase catalytic domain |
WS_DGAT_C | PF06974.19 | 4.0e-12 | 321–460 | WS/DGAT C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: plsC (bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase), high confidence from genomic context alone (score 995 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2483c plsC |
bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase | 996 | 995 ctx | neighborhood:882 cooccurence:657 coexpression:833 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 988 | 979 ctx | neighborhood:881 cooccurence:723 coexpression:409 textmining:470 |
Rv3097c lipY |
triacylglycerol lipase Lip | 904 | 904 | database:900 |
Rv2252 dagK |
diacylglycerol kinase | 902 | 903 | database:900 |
Rv2481c hyp |
hypothetical protein | 753 | 753 ctx | neighborhood:749 |
Rv3800c pks13 |
polyketide synthase | 808 | 746 | coexpression:710 |
Rv3391 acrA1 |
acyl-CoA-reductase AcrA | 888 | 737 ctx | cooccurence:539 coexpression:421 textmining:593 |
Rv2383c mbtB |
phenyloxazoline synthase | 795 | 712 | coexpression:650 |
Rv3233c |
Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 | 929 | 701 ctx | cooccurence:699 textmining:774 |
Rv1551 plsB1 |
acyltransferase PlsB | 772 | 694 ctx | cooccurence:649 |
Rv2485c lipQ |
carboxylesterase LipQ | 740 | 558 ctx | neighborhood:449 textmining:435 |
Rv2478c hyp |
hypothetical protein | 544 | 544 ctx | neighborhood:544 |
Rv2627c hyp |
hypothetical protein | 541 | 542 ctx | cooccurence:526 |
Rv0293c hyp |
hypothetical protein | 527 | 527 ctx | cooccurence:522 |
Rv0101 nrp |
peptide synthetase Nrp | 543 | 518 | coexpression:481 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: diacyglycerol O-acyltransferase
- MTBC0 PGAP product: wax ester/triacylglycerol synthase family O-acyltransferase
- Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=2e-80), WS_DGAT_C PF06974.19 (E=4e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217000.1)
- Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WKB3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
50 functional partner(s); context anchor
plsC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002644|Rv2484c| MAESGESPRLSDELGPVDYLMHRGEANPRTRSGIMALELLDGTPDWDRFRTRFENASRRVLRLRQKVVVPTLPTAAPRWVVDPDFNLDFHVRRVRVSGPATLREVLDLAEVILQSPLDISRPLWTATLVEGMADGRAAMLLHVSHAVTDGVGGVEMFAQIYDLERDPPPRSTPPQPIPEDLSPNDLMRRGINHLPIAVVGGVLDALSGAVSMAGRAVLEPVSTVSGILGYARSGIRVLNRAAEPSPLLRRRSLTTRTEAIDIRLADLHKAAKAGGGSINDAYLAGLCGALRRYHEALGVPISTLPMAVPVNLRAEGDAAGGNQFTGVNLAAPVGTIDPVARMKKIRAQMTQRRDEPAMNIIGSIAPVLSVLPTAVLEGITGSVIGSDVQASNVPVYPGDTYLAGAKILRQYGIGPLPGVAMMVVLISRGGWCTVTVRYDRASVRNDELFAQCLQAGFDEILALAGDPAPRVLPASFDTQGAGSVPRSVSGS