PE_PGRS38 Family assigned · medium auto-curated

H37Rv Rv2162c · MTBC0 - · 532 aa · 2423240–2424838 (-) · RefSeq YP_177865.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE-PGRS family protein PE_PGRS38
MTBC0 PGAP re-annotation
Revised (this work)PE-PGRS family protein PE_PGRS38. Pfam: PE (PF00934.26), PGRS (PF21526.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L7N6A1 TrEMBL · unreviewed · Evidence at protein level
UniProt namePE-PGRS family protein PE_PGRS38

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionPE family
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.443 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 11 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 8.9e-354–94 PE family
PGRSPF21526.3 4.8e-12116–184 PGRS repeats

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsmH (rRNA small subunit methyltransferase H), medium confidence from genomic context alone (score 443 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2161c hyp hypothetical protein 905 540 ctx neighborhood:540 textmining:803
Rv2165c rsmH rRNA small subunit methyltransferase H 443 443 ctx neighborhood:443
Rv2164c hyp hypothetical protein 443 443 ctx neighborhood:443
Rv2163c pbpB penicillin-binding membrane protein PbpB 443 443 ctx neighborhood:443
Rv2166c mraZ transcriptional regulator MraZ 440 440 ctx neighborhood:440
Rv2160c Rv2160c, (MTCY270.08), len: 113 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator, similar to C-terminal 863 336 textmining:803
Rv2159c hyp hypothetical protein 805 57 textmining:802
Rv2158c murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase 436 50 textmining:431
Rv2151c ftsQ cell division protein FtsQ 435 49 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS38
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=9e-35), PGRS PF21526.3 (E=5e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177865.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt L7N6A1 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor rsmH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2162c|PE_PGRS38
MSFVIAAPEVMAAAATDLANIGSSISAASAAAAGPTMGILAAGADEVSVAISALFGSHAQGYQTLSAQLAAYHNQFVRALNAGAGSYASAEAANVQQTLLNAINAPTQTLLGRPLIGNGADGGPGQNGGPGGLLYGNGGNGGAGDTANPNGGNGGSAGLIGNGGAGGAGAATGAGGAGGNGGWLYGNGGPGGAAGLGTAGGVSPAGGAGGAAGLWGHGGAGGAGGSASGAPGAGGAGGDGGRGGLLYGDGGAGGAGGNGSNGVTGVHGGNGGAGGAAGLIGNGGAGGDGGNGGLSNTGASGGAGGAGGAALIGNGGDGGHGGNGGHGNSGGAGGAGGAGGAGGAGGHVGLIGNGGNGGAGGNGGNDNSSTLADAGSGGAGAAGGNGGLFYGNGGVGGRGGNGGFSSAGTSGGDGGIGGAGGIGGLIGSGGGGGDGGNGGQAPTPGNAGDGGAGGNARLIGDGGRGGNGGEGGDGPPGVKGDGGNGGNGGNAVVIGNGGNGGAGGFGIPVGSGGAGGSRGVLFGTPGANGADG