murD Resolved · high auto-curated

H37Rv Rv2155c · MTBC0 mtbc0_002291 · 486 aa · 2442313–2443773 (-) · RefSeq NP_216671.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)UDP-N-acetylmuramoylalanine--D-glutamate ligase
MTBC0 PGAP re-annotationUDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
Revised (this work)UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase. Pfam: Mur_ligase_M (PF08245.19), Mur_ligase_C (PF02875.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJL5 SwissProt · reviewed · Evidence at protein level
UniProt nameUDP-N-acetylmuramoylalanine--D-glutamate ligase
EC (curated) EC 6.3.2.9
Curated functionCell wall formation. Catalyzes the addition of glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanine (UMA).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namemurD
eggNOG descriptionCell wall formation. Catalyzes the addition of glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanine (UMA)
Orthologous groupCOG0771
EC number EC 6.3.2.9
KEGG orthology K01925
KEGG pathways map00471, map00550, map01100
Gene Ontology (10) GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0040007, GO:0044424, GO:0044444, GO:0044464

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.799 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 14 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Mur_ligase_MPF08245.19 7.1e-19118–290 Mur ligase middle domain
Mur_ligase_CPF02875.27 3.4e-07313–461 Mur ligase, glutamate ligase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: murG (UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2153c murG UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase 999 999 ctx neighborhood:876 cooccurence:713 coexpression:968 textmining:894
Rv2157c murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 999 998 ctx neighborhood:881 cooccurence:712 coexpression:942 textmining:957
Rv2152c murC UDP-N-acetylmuramate--alanine ligase 999 998 ctx neighborhood:876 coexpression:779 database:900 textmining:795
Rv2158c murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase 998 996 ctx neighborhood:881 coexpression:570 database:900 textmining:746
Rv2156c murX phospho-N-acetylmuramoyl-pentappeptidetransferase 996 991 ctx neighborhood:881 cooccurence:695 coexpression:780 textmining:649
Rv2151c ftsQ cell division protein FtsQ 992 983 ctx neighborhood:876 coexpression:865 textmining:608
Rv2154c ftsW lipid II flippase FtsW 992 972 ctx neighborhood:876 cooccurence:472 coexpression:607 textmining:741
Rv1338 murI glutamate racemase 994 957 ctx cooccurence:550 database:900 textmining:878
Rv0788 purQ phosphoribosylformylglycinamidine synthase 902 902 database:900
Rv2163c pbpB penicillin-binding membrane protein PbpB 937 854 ctx neighborhood:544 cooccurence:535 textmining:588
Rv2981c ddlA D-alanine--D-alanine ligase 959 765 coexpression:639 textmining:834
Rv2160A Rv2160A, len: 211 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator,similar to N-terminal half of AL51266 756 756 ctx neighborhood:712
Rv2159c hyp hypothetical protein 730 730 ctx neighborhood:709
Rv2150c ftsZ cell division protein FtsZ 923 719 ctx neighborhood:561 textmining:738
Rv1302 rfe decaprenyl-phosphate N-acetylglucosaminephosphotransferase 748 714 coexpression:698

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: UDP-N-acetylmuramoylalanine--D-glutamate ligase
  • MTBC0 PGAP product: UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  • Pfam (hmmscan --cut_ga): Mur_ligase_M PF08245.19 (E=7e-19), Mur_ligase_C PF02875.27 (E=3e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216671.3)
  • Domains: Pfam-A via hmmscan --cut_ga — Mur_ligase_M (PF08245.19), Mur_ligase_C (PF02875.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0771
  • Curated reference: UniProt P9WJL5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor murG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002291|Rv2155c|murD
MLDPLGPGAPVLVAGGRVTGQAVAAVLTRFGATPTVCDDDPVMLRPHAERGLPTVSSSDAVQQITGYALVVASPGFSPATPLLAAAAAAGVPIWGDVELAWRLDAAGCYGPPRSWLVVTGTNGKTTTTSMLHAMLIAGGRRAVLCGNIGSAVLDVLDEPAELLAVELSSFQLHWAPSLRPEAGAVLNIAEDHLDWHATMAEYTAAKARVLTGGVAVAGLDDSRAAALLDGSPAQVRVGFRLGEPAAGELGVRDAHLVDRAFSDDLTLLPVASIPVPGPVGVLDALAAAALARSVGVPAGAIADAVTSFRVGRHRAEVVAVADGITYVDDSKATNPHAARASVLAYPRVVWIAGGLLKGASLHAEVAAMASRLVGAVLIGRDRAAVAEALSRHAPDVPVVQVVAGEDTGMPATVEVPVACVLDVAKDDKAGETVGAAVMTAAVAAARRMAQPGDTVLLAPAGASFDQFTGYADRGEAFATAVRAVIR