murX Resolved · high auto-curated

H37Rv Rv2156c · MTBC0 mtbc0_002292 · 359 aa · 2443775–2444854 (-) · RefSeq NP_216672.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phospho-N-acetylmuramoyl-pentappeptidetransferase
MTBC0 PGAP re-annotationphospho-N-acetylmuramoyl-pentapeptide-transferase
Revised (this work)Phospho-N-acetylmuramoyl-pentapeptide-transferase. Pfam: MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMW7 SwissProt · reviewed · Evidence at protein level
UniProt namePhospho-N-acetylmuramoyl-pentapeptide-transferase
EC (curated) EC 2.7.8.13
Curated functionCatalyzes the initial step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan: transfers peptidoglycan precursor phospho-MurNAc-pentapeptide from UDP-MurNAc-pentapeptide onto the lipid carrier undecaprenyl phosphate, yielding undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide, known as lipid I.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namemraY
eggNOG descriptionFirst step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan
Orthologous groupCOG0472
EC number EC 2.7.8.13
KEGG orthology K01000
KEGG pathways map00550, map01100, map01502
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.274 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MraY_sig1PF10555.15 1.8e-0546–58 Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1
Glycos_transf_4PF00953.27 2.2e-3686–276 Glycosyl transferase family 4

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: murF (UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2157c murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 999 1000 ctx neighborhood:882 cooccurence:669 coexpression:909 database:900 textmining:609
Rv2153c murG UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase 999 998 ctx neighborhood:876 cooccurence:713 coexpression:493 database:900 textmining:798
Rv2155c murD UDP-N-acetylmuramoylalanine--D-glutamate ligase 996 991 ctx neighborhood:881 cooccurence:695 coexpression:780 textmining:649
Rv2152c murC UDP-N-acetylmuramate--alanine ligase 992 981 ctx neighborhood:876 cooccurence:732 coexpression:470 textmining:638
Rv2158c murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase 991 980 ctx neighborhood:881 cooccurence:714 coexpression:473 textmining:599
Rv2154c ftsW lipid II flippase FtsW 984 976 ctx neighborhood:876 cooccurence:666 coexpression:465
Rv2151c ftsQ cell division protein FtsQ 937 928 ctx neighborhood:876 coexpression:442
Rv2136c uppP undecaprenyl-diphosphatase 926 919 database:900
Rv2163c pbpB penicillin-binding membrane protein PbpB 882 875 ctx neighborhood:544 cooccurence:697
Rv0017c rodA cell division protein RodA 833 781 ctx cooccurence:596 coexpression:463
Rv2160A Rv2160A, len: 211 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator,similar to N-terminal half of AL51266 760 760 ctx neighborhood:712
Rv1315 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase 908 749 ctx cooccurence:733 textmining:649
Rv2159c hyp hypothetical protein 747 747 ctx neighborhood:709
Rv2150c ftsZ cell division protein FtsZ 762 731 ctx neighborhood:561
Rv2981c ddlA D-alanine--D-alanine ligase 848 677 ctx cooccurence:463 textmining:551

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phospho-N-acetylmuramoyl-pentappeptidetransferase
  • MTBC0 PGAP product: phospho-N-acetylmuramoyl-pentapeptide-transferase
  • Pfam (hmmscan --cut_ga): MraY_sig1 PF10555.15 (E=2e-05), Glycos_transf_4 PF00953.27 (E=2e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216672.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0472
  • Curated reference: UniProt P9WMW7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 53 functional partner(s); context anchor murF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002292|Rv2156c|murX
MRQILIAVAVAVTVSILLTPVLIRLFTKQGFGHQIREDGPPSHHTKRGTPSMGGVAILAGIWAGYLGAHLAGLAFDGEGIGASGLLVLGLATALGGVGFIDDLIKIRRSRNLGLNKTAKTVGQITSAVLFGVLVLQFRNAAGLTPGSADLSYVREIATVTLAPVLFVLFCVVIVSAWSNAVNFTDGLDGLAAGTMAMVTAAYVLITFWQYRNACVTAPGLGCYNVRDPLDLALIAAATAGACIGFLWWNAAPAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGALFVAEITSVVLQILTFRTTGRRMFRMAPFHHHFELVGWAETTVIIRFWLLTAITCGLGVALFYGEWLAAVGA