murX Resolved · high auto-curated
H37Rv Rv2156c · MTBC0 mtbc0_002292 ·
359 aa · 2443775–2444854 (-) ·
RefSeq NP_216672.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phospho-N-acetylmuramoyl-pentappeptidetransferase |
|---|---|
| MTBC0 PGAP re-annotation | phospho-N-acetylmuramoyl-pentapeptide-transferase |
| Revised (this work) | Phospho-N-acetylmuramoyl-pentapeptide-transferase. Pfam: MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMW7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phospho-N-acetylmuramoyl-pentapeptide-transferase |
| EC (curated) |
EC 2.7.8.13
|
| Curated function | Catalyzes the initial step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan: transfers peptidoglycan precursor phospho-MurNAc-pentapeptide from UDP-MurNAc-pentapeptide onto the lipid carrier undecaprenyl phosphate, yielding undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide, known as lipid I. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | mraY |
| eggNOG description | First step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan |
| Orthologous group | COG0472 |
| EC number |
EC 2.7.8.13
|
| KEGG orthology |
K01000
|
| KEGG pathways |
map00550, map01100, map01502
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.274 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MraY_sig1 | PF10555.15 | 1.8e-05 | 46–58 | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
Glycos_transf_4 | PF00953.27 | 2.2e-36 | 86–276 | Glycosyl transferase family 4 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: murF (UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2157c murF |
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase | 999 | 1000 ctx | neighborhood:882 cooccurence:669 coexpression:909 database:900 textmining:609 |
Rv2153c murG |
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase | 999 | 998 ctx | neighborhood:876 cooccurence:713 coexpression:493 database:900 textmining:798 |
Rv2155c murD |
UDP-N-acetylmuramoylalanine--D-glutamate ligase | 996 | 991 ctx | neighborhood:881 cooccurence:695 coexpression:780 textmining:649 |
Rv2152c murC |
UDP-N-acetylmuramate--alanine ligase | 992 | 981 ctx | neighborhood:876 cooccurence:732 coexpression:470 textmining:638 |
Rv2158c murE |
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase | 991 | 980 ctx | neighborhood:881 cooccurence:714 coexpression:473 textmining:599 |
Rv2154c ftsW |
lipid II flippase FtsW | 984 | 976 ctx | neighborhood:876 cooccurence:666 coexpression:465 |
Rv2151c ftsQ |
cell division protein FtsQ | 937 | 928 ctx | neighborhood:876 coexpression:442 |
Rv2136c uppP |
undecaprenyl-diphosphatase | 926 | 919 | database:900 |
Rv2163c pbpB |
penicillin-binding membrane protein PbpB | 882 | 875 ctx | neighborhood:544 cooccurence:697 |
Rv0017c rodA |
cell division protein RodA | 833 | 781 ctx | cooccurence:596 coexpression:463 |
Rv2160A |
Rv2160A, len: 211 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator,similar to N-terminal half of AL51266 | 760 | 760 ctx | neighborhood:712 |
Rv1315 murA |
UDP-N-acetylglucosamine 1-carboxyvinyltransferase | 908 | 749 ctx | cooccurence:733 textmining:649 |
Rv2159c hyp |
hypothetical protein | 747 | 747 ctx | neighborhood:709 |
Rv2150c ftsZ |
cell division protein FtsZ | 762 | 731 ctx | neighborhood:561 |
Rv2981c ddlA |
D-alanine--D-alanine ligase | 848 | 677 ctx | cooccurence:463 textmining:551 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: phospho-N-acetylmuramoyl-pentappeptidetransferase
- MTBC0 PGAP product: phospho-N-acetylmuramoyl-pentapeptide-transferase
- Pfam (hmmscan --cut_ga): MraY_sig1 PF10555.15 (E=2e-05), Glycos_transf_4 PF00953.27 (E=2e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216672.1)
- Domains: Pfam-A via hmmscan --cut_ga — MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0472 - Curated reference: UniProt P9WMW7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
53 functional partner(s); context anchor
murF - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002292|Rv2156c|murX MRQILIAVAVAVTVSILLTPVLIRLFTKQGFGHQIREDGPPSHHTKRGTPSMGGVAILAGIWAGYLGAHLAGLAFDGEGIGASGLLVLGLATALGGVGFIDDLIKIRRSRNLGLNKTAKTVGQITSAVLFGVLVLQFRNAAGLTPGSADLSYVREIATVTLAPVLFVLFCVVIVSAWSNAVNFTDGLDGLAAGTMAMVTAAYVLITFWQYRNACVTAPGLGCYNVRDPLDLALIAAATAGACIGFLWWNAAPAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGALFVAEITSVVLQILTFRTTGRRMFRMAPFHHHFELVGWAETTVIIRFWLLTAITCGLGVALFYGEWLAAVGA