murX Resolved · high auto-curated
H37Rv Rv2156c · MTBC0 mtbc0_002292 ·
359 aa ·
2443775–2444854 MTBC0
(-) ·
RefSeq NP_216672.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phospho-N-acetylmuramoyl-pentappeptidetransferase |
|---|---|
| MTBC0 PGAP re-annotation | phospho-N-acetylmuramoyl-pentapeptide-transferase |
| Revised (this work) | Phospho-N-acetylmuramoyl-pentapeptide-transferase. Pfam: MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (6 in a M. tuberculosis context).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | murF (Rv2157c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -8.53 (95% CI -9.59 to -7.42). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in cell wall formation; peptidoglycan biosynthesis. |
|---|---|
| Mycobrowser EC |
2.7.8.13
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2180c
· 100.0% identity |
|---|---|
| M. leprae |
ML0911
· 91.1% identity |
| M. marinum |
MMAR_3196
· 92.5% identity |
| M. smegmatis |
MSMEG_4230
· 87.2% identity |
| M. orygis |
RJtmp_002227
· 100.0% identity |
| M. abscessus |
MAB_2003
· 80.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMW7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phospho-N-acetylmuramoyl-pentapeptide-transferase |
| EC (curated) |
EC 2.7.8.13
|
| Curated function | Catalyzes the initial step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan: transfers peptidoglycan precursor phospho-MurNAc-pentapeptide from UDP-MurNAc-pentapeptide onto the lipid carrier undecaprenyl phosphate, yielding undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide, known as lipid I. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | mraY |
| eggNOG description | First step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan |
| Orthologous group | COG0472 |
| EC number |
EC 2.7.8.13
|
| KEGG orthology |
K01000
|
| KEGG pathways |
map00550, map01100, map01502
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.274 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.183 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 90.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 57.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 12 in the ORF — 12 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | H37RvMA::Rv2156c(mraY)-FLAG/DAS+pTetON-18 sspB (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 4.803 median doublings (across 1 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | no (Excluded - not in all screening waves) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 16.3 ppm · rank 2452/3519 (30.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (10 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 10 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 359 aa |
|---|---|
| Molecular weight | 37.7 kDa |
| Theoretical pI | 9.08 |
| GRAVY | 0.803 (hydrophobic) |
| Aliphatic index | 120.1 |
| Aromaticity | 0.092 |
| Instability index | 29.1 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MraY_sig1 | PF10555.15 | 1.8e-05 | 46–58 | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
Glycos_transf_4 | PF00953.27 | 2.2e-36 | 86–276 | Glycosyl transferase family 4 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5ckr-assembly1_A-2 |
1.00 | 0.90 | 3.9e-19 sig | 5ckr-assembly1_A-2 Crystal Structure of MraY in complex with Muraymycin D2 |
9b70-assembly1_B |
1.00 | 0.88 | 1.4e-19 sig | 9b70-assembly1_B Cryo-EM structure of MraY in complex with analogue 2 |
6oyh-assembly4_D |
1.00 | 0.88 | 3.5e-19 sig | 6oyh-assembly4_D Crystal structure of MraY bound to carbacaprazamycin |
6oyh-assembly1_A |
1.00 | 0.87 | 4.4e-18 sig | 6oyh-assembly1_A Crystal structure of MraY bound to carbacaprazamycin |
8tlu-assembly1_A |
1.00 | 0.84 | 2.9e-18 sig | 8tlu-assembly1_A E. coli MraY mutant-T23P |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 9
| Upstream (5' on genome) | murD (- strand, 1 bp gap) |
|---|---|
| Downstream (3' on genome) | murF (- strand, -4 bp gap) |
| Predicted operon |
ftsQ · murC · murG · ftsW · murD · murX · murF · murE · Rv2159c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: murF (UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2157c murF exp |
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase | 999 | 1000 ctx | neighborhood:882 cooccurence:669 coexpression:909 database:900 textmining:609 |
Rv2153c murG exp |
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase | 999 | 998 ctx | neighborhood:876 cooccurence:713 coexpression:493 database:900 textmining:798 |
Rv2155c murD |
UDP-N-acetylmuramoylalanine--D-glutamate ligase | 996 | 991 ctx | neighborhood:881 cooccurence:695 coexpression:780 textmining:649 |
Rv2152c murC |
UDP-N-acetylmuramate--alanine ligase | 992 | 981 ctx | neighborhood:876 cooccurence:732 coexpression:470 textmining:638 |
Rv2158c murE |
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase | 991 | 980 ctx | neighborhood:881 cooccurence:714 coexpression:473 textmining:599 |
Rv2154c ftsW |
lipid II flippase FtsW | 984 | 976 ctx | neighborhood:876 cooccurence:666 coexpression:465 |
Rv2151c ftsQ |
cell division protein FtsQ | 937 | 928 ctx | neighborhood:876 coexpression:442 |
Rv2136c uppP exp |
undecaprenyl-diphosphatase | 926 | 919 | database:900 |
Rv2163c pbpB |
penicillin-binding membrane protein PbpB | 882 | 875 ctx | neighborhood:544 cooccurence:697 |
Rv0017c rodA |
cell division protein RodA | 833 | 781 ctx | cooccurence:596 coexpression:463 |
Rv2160A |
Rv2160A, len: 211 aa. Conserved hypothetical protein, possibly a TetR-family transcriptional regulator,similar to N-terminal half of AL51266 | 760 | 760 ctx | neighborhood:712 |
Rv1315 murA |
UDP-N-acetylglucosamine 1-carboxyvinyltransferase | 908 | 749 ctx | cooccurence:733 textmining:649 |
Rv2159c hyp |
hypothetical protein | 747 | 747 ctx | neighborhood:709 |
Rv2150c ftsZ |
cell division protein FtsZ | 762 | 731 ctx | neighborhood:561 |
Rv2981c ddlA |
D-alanine--D-alanine ligase | 848 | 677 ctx | cooccurence:463 textmining:551 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: phospho-N-acetylmuramoyl-pentappeptidetransferase
- MTBC0 PGAP product: phospho-N-acetylmuramoyl-pentapeptide-transferase
- Pfam (hmmscan --cut_ga): MraY_sig1 PF10555.15 (E=2e-05), Glycos_transf_4 PF00953.27 (E=2e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216672.1)
- Domains: Pfam-A via hmmscan --cut_ga — MraY_sig1 (PF10555.15), Glycos_transf_4 (PF00953.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0472 - Curated reference: UniProt P9WMW7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
53 functional partner(s); context anchor
murF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002292|Rv2156c|murX MRQILIAVAVAVTVSILLTPVLIRLFTKQGFGHQIREDGPPSHHTKRGTPSMGGVAILAGIWAGYLGAHLAGLAFDGEGIGASGLLVLGLATALGGVGFIDDLIKIRRSRNLGLNKTAKTVGQITSAVLFGVLVLQFRNAAGLTPGSADLSYVREIATVTLAPVLFVLFCVVIVSAWSNAVNFTDGLDGLAAGTMAMVTAAYVLITFWQYRNACVTAPGLGCYNVRDPLDLALIAAATAGACIGFLWWNAAPAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGALFVAEITSVVLQILTFRTTGRRMFRMAPFHHHFELVGWAETTVIIRFWLLTAITCGLGVALFYGEWLAAVGA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for murX? Email the maintainer — the message is pre-filled with this gene's details.