mmpL6 Resolved · high auto-curated
H37Rv Rv1557 · MTBC0 - ·
397 aa ·
1761744–1762937 H37Rv
(+) ·
RefSeq NP_216073.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane transport protein MmpL6 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Transmembrane transport protein MmpL6. Pfam: MMPL (PF03176.22). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Whole genome sequencing-based identification of human tuberculosis caused by animal-lineage Mycobacterium orygis. doi:10.1128/jcm.00260-23 | 2023 |
| The TbD1 Locus Mediates a Hypoxia-Induced Copper Response in Mycobacterium bovis. doi:10.3389/fmicb.2022.817952 | 2022 |
| TbD1 deletion as a driver of the evolutionary success of modern epidemic Mycobacterium tuberculosis lineages. doi:10.1038/s41467-020-14508-5 | 2020 |
| The MmpS6-MmpL6 Operon Is an Oxidative Stress Response System Providing Selective Advantage to Mycobacterium tuberculosis in Stress. doi:10.1093/infdis/jiy526 | 2019 |
| Molecular characterization of Mycobacterium orygis isolates from wild animals of Nepal. | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.95 (95% CI -1.13 to 4.00). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Unknown. Thought to be involved in fatty acid transport. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Curated reference (UniProt)
| UniProt |
P9WJU9
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable transport protein MmpL6 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | mmpL6 |
| eggNOG description | MMPL family |
| Orthologous group | COG2409 |
| KEGG orthology |
K06994
|
| Gene Ontology (4) |
GO:0008150, GO:0010033, GO:0042221, GO:0050896
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.451 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 44.6% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 21 in the ORF — 0 in the essential state, 0 growth-defect, 21 non-essential, 0 growth-advantage. Saturation 0.952, mean read count 178.05. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 2 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.14 ppm · rank 3462/3519 (1.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 397 aa |
|---|---|
| Molecular weight | 42.4 kDa |
| Theoretical pI | 5.98 |
| GRAVY | 0.479 (hydrophobic) |
| Aliphatic index | 118.0 |
| Aromaticity | 0.073 |
| Instability index | 28.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MMPL | PF03176.22 | 9.3e-105 | 29–364 | MMPL family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 78.5
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
9b43-assembly1_A |
1.00 | 0.87 | 2.0e-19 sig | 9b43-assembly1_A Mycolicibacterium smegmatis MmpL4 structure |
9b46-assembly1_A |
1.00 | 0.89 | 4.3e-18 sig | 9b46-assembly1_A Mycolicibacterium smegmatis MmpL5 structure |
7rpk-assembly1_A |
1.00 | 0.82 | 7.1e-03 sig | 7rpk-assembly1_A Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog |
7rpi-assembly1_A |
1.00 | 0.82 | 7.8e-03 sig | 7rpi-assembly1_A Cryo-EM structure of murine Dispatched 'T' conformation |
7e2i-assembly1_D |
1.00 | 0.57 | 6.2e-03 sig | 7e2i-assembly1_D Cryo-EM structure of hDisp1NNN-ShhN |
Foldseek search of the AlphaFold DB model (mean pLDDT 78.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 5
| Upstream (5' on genome) | Rv1556 (+ strand, 138 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1558 (+ strand, 9 bp gap) |
| Predicted operon |
mmpL6 · Rv1558 · ilvA · vapB11 · vapC11
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0135c (represses) · Rv1353c (activates) · Rv1556 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mmpL13a (transmembrane transport protein), medium confidence from genomic context alone (score 690 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1558 hyp |
hypothetical protein | 868 | 868 ctx | neighborhood:867 |
Rv1145 mmpL13a |
transmembrane transport protein | 706 | 690 ctx | cooccurence:687 |
Rv1559 ilvA |
threonine dehydratase IlvA | 680 | 681 ctx | neighborhood:676 |
Rv1556 |
HTH-type transcriptional regulator | 572 | 572 ctx | neighborhood:498 |
Rv1560 vapB11 |
antitoxin VapB11 | 561 | 561 ctx | neighborhood:556 |
Rv1561 vapC11 |
ribonuclease VapC11 | 561 | 561 ctx | neighborhood:556 |
Rv1598c hyp |
hypothetical protein | 460 | 461 ctx | cooccurence:459 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 428 | 429 ctx | cooccurence:427 |
Rv2147c sepF |
cell division protein SepF | 400 | 372 | |
Rv2945c lppX |
lipoprotein LppX | 489 | 323 | |
Rv0202c mmpL11 |
transmembrane transport protein MmpL11 | 446 | 310 | |
Rv1551 plsB1 |
acyltransferase PlsB | 405 | 233 | |
Rv1856c |
oxidoreductase | 430 | 196 | |
Rv0078 |
transcriptional regulator | 810 | 66 | textmining:805 |
Rv1472 echA12 |
enoyl-CoA hydratase EchA12 | 439 | 52 | textmining:433 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transmembrane transport protein MmpL6
- Pfam (hmmscan --cut_ga): MMPL PF03176.22 (E=9e-105)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216073.1)
- Domains: Pfam-A via hmmscan --cut_ga — MMPL (PF03176.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2409 - Curated reference: UniProt P9WJU9 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 78.5)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
mmpL13a - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1557|mmpL6 MQGISVTGLVKRGWMVRSVFDTIDGIDQLGEQLASVTVTLDKLAAIQPQLVALLPDEIASQQINRELALANYATMSGIYAQTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRGLKLFLSADGKAARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAATFKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGASFGLSVLVWQHLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGAGLNTGIIRAMAGTGGVVTAAGLVFAATMSSFVFSDLRVLGQIGTTIGLGLLFDTLVVRAFMTPSIAVLLGRWFWWPQRVRPRPASRMLRPYGPRPVVRELLLREGNDDPRTQVATHR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mmpL6? Email the maintainer — the message is pre-filled with this gene's details.