frdC Family assigned · medium auto-curated
H37Rv Rv1554 · MTBC0 mtbc0_001661 ·
126 aa ·
1769986–1770366 MTBC0
(+) ·
RefSeq NP_216070.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | fumarate reductase membrane anchor subunit |
|---|---|
| MTBC0 PGAP re-annotation | fumarate reductase subunit C |
| Revised (this work) | Fumarate reductase subunit C. Pfam: Fumarate_red_C (PF02300.23). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | sdhB (Rv1553, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
Unc_9, SG_13.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.58 (95% CI -1.64 to 3.84). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in interconversion of fumarate and succinate (anaerobic respiration). This hydrophobic component may be required to anchor the catalytic components of the fumarate reductase complex to the cytoplasmic membrane. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. orygis |
RJtmp_001641
· 99.2% identity |
|---|
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WNB7
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Fumarate reductase subunit C |
| Curated function | Anchors the catalytic components of the fumarate reductase complex to the cell membrane, binds quinones. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | frdC |
| eggNOG description | Seems to be involved in the anchoring of the catalytic components of the fumarate reductase complex to the cytoplasmic membrane |
| Orthologous group | COG3029 |
| KEGG orthology |
K00246
|
| KEGG pathways |
map00020, map00190, map00620, map00650, map00720, map01100, map01110, map01120, map01130, map01200, map02020
|
| KEGG modules |
M00009, M00011, M00150, M00173
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.48 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.49% of strains (705) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.345
· 10 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.345) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 4/53 (8%) · mean identity 75.9%
· 4/4 closest MTBAP relatives present in a subset of the genus (4/53 NTM; in 4 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 31.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 107.7. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 2 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.66 ppm · rank 3329/3519 (5.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (3 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 3 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 126 aa |
|---|---|
| Molecular weight | 14.4 kDa |
| Theoretical pI | 11.47 |
| GRAVY | 0.755 (hydrophobic) |
| Aliphatic index | 122.1 |
| Aromaticity | 0.151 |
| Instability index | 47.9 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Fumarate_red_C | PF02300.23 | 1.2e-42 | 3–125 | Fumarate reductase subunit C |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6awf-assembly1_C |
1.00 | 0.87 | 2.4e-08 sig | 6awf-assembly1_C Escherichia coli quinol:fumarate reductase crystallized without dicarboxylate |
4kx6-assembly2_O |
1.00 | 0.87 | 3.4e-08 sig | 4kx6-assembly2_O Plasticity of the quinone-binding site of the complex II homolog quinol:fumarate reductase |
4kx6-assembly1_C |
1.00 | 0.87 | 9.4e-08 sig | 4kx6-assembly1_C Plasticity of the quinone-binding site of the complex II homolog quinol:fumarate reductase |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | frdB (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | frdD (+ strand, -4 bp gap) |
| Predicted operon |
frdA · frdB · frdC · frdD
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: frdB (fumarate reductase iron-sulfur subunit), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1553 frdB exp |
fumarate reductase iron-sulfur subunit | 999 | 1000 ctx | neighborhood:881 cooccurence:662 coexpression:912 experimental:549 database:900 textmining:824 |
Rv1552 frdA exp |
fumarate reductase flavoprotein subunit | 999 | 1000 ctx | neighborhood:881 cooccurence:616 coexpression:879 experimental:469 database:900 textmining:799 |
Rv1555 frdD exp |
fumarate reductase membrane anchor subunit | 999 | 1000 ctx | neighborhood:881 cooccurence:774 coexpression:939 experimental:895 database:900 textmining:850 |
Rv0247c exp |
succinate dehydrogenase iron-sulfur subunit | 983 | 974 | coexpression:452 experimental:549 database:900 |
Rv3319 sdhB exp |
succinate dehydrogenase iron-sulphur protein subunit | 981 | 974 | coexpression:452 experimental:549 database:900 |
Rv3318 sdhA exp |
succinate dehydrogenase flavoprotein subunit | 984 | 967 | coexpression:403 experimental:469 database:900 textmining:569 |
Rv0248c exp |
succinate dehydrogenase flavoprotein subunit | 975 | 967 | coexpression:401 experimental:469 database:900 |
Rv3317 sdhD exp |
succinate dehydrogenase hydrophobic membrane anchor subunit | 966 | 901 | database:900 textmining:680 |
Rv3316 sdhC exp |
succinate dehydrogenase cytochrome B-556 subunit | 954 | 900 | database:900 textmining:565 |
Rv1098c fum exp |
fumarate hydratase | 900 | 900 | database:900 |
Rv1659 argH exp |
argininosuccinate lyase | 801 | 801 | database:800 |
Rv3221c TB7.3 exp |
acetyl-CoA carboxylase biotin carboxyl carrier protein subunit | 801 | 801 | database:800 |
Rv2501c accA1 exp |
acetyl/propionyl-CoA carboxylase subuit alpha | 800 | 801 | database:800 |
Rv0337c aspC exp |
aspartate aminotransferase | 800 | 800 | database:800 |
Rv0951 sucC exp |
succinyl-CoA ligase subunit beta | 800 | 800 | database:800 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: fumarate reductase membrane anchor subunit
- MTBC0 PGAP product: fumarate reductase subunit C
- Pfam (hmmscan --cut_ga): Fumarate_red_C PF02300.23 (E=1e-42)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216070.1)
- Domains: Pfam-A via hmmscan --cut_ga — Fumarate_red_C (PF02300.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3029 - Curated reference: UniProt P9WNB7 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
43 functional partner(s); context anchor
frdB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001661|Rv1554|frdC MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLVLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for frdC? Email the maintainer — the message is pre-filled with this gene's details.