PPE39 Family assigned · medium auto-curated

H37Rv Rv2353c · MTBC0 - · 354 aa · 2634528–2635592 (-) · RefSeq YP_177871.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PPE family protein PPE39
MTBC0 PGAP re-annotation
Revised (this work)PPE family protein PPE39. Pfam: Pentapeptide_2 (PF01469.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FF3 TrEMBL · unreviewed · Predicted
UniProt namePPE family protein PPE39

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.132 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Pentapeptide_2PF01469.25 5.2e-107–45 Pentapeptide repeats (8 copies)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS23 (PE-PGRS family protein PE_PGRS23), high confidence from genomic context alone (score 763 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1243c PE_PGRS23 PE-PGRS family protein PE_PGRS23 763 763 ctx cooccurence:763
Rv0124 PE_PGRS2 PE-PGRS family protein PE_PGRS2 743 743 ctx cooccurence:743
Rv1004c membrane protein 732 732 ctx cooccurence:732
Rv2126c PE_PGRS37 PE-PGRS family protein PE_PGRS37 737 730 ctx cooccurence:730
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 729 729 ctx cooccurence:729
Rv3864 espE ESX-1 secretion-associated protein EspE 724 725 ctx cooccurence:722
Rv0341 iniB isoniazid inducible protein IniB 695 696 ctx cooccurence:695
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 676 676 ctx cooccurence:676
Rv2082 hyp hypothetical protein 671 672 ctx cooccurence:669
Rv0613c hyp hypothetical protein 669 669 ctx cooccurence:668
Rv3879c espK ESX-1 secretion-associated protein EspK 650 650 ctx cooccurence:650
Rv2209 integral membrane protein 647 647 ctx cooccurence:645
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 634 634 ctx cooccurence:634
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 619 619 ctx cooccurence:619
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 612 612 ctx cooccurence:612

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE39
  • Pfam (hmmscan --cut_ga): Pentapeptide_2 PF01469.25 (E=5e-10)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177871.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Pentapeptide_2 (PF01469.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt Q79FF3 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor PE_PGRS23
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2353c|PPE39
MPGRFRNFGSQNLGSGNIGSTNVGSGNIGSTNVGSGNIGDTNFGNGNNGNFNFGSGNTGSNNIGFGNTGSGNFGFGNTGNNNIGIGLTGDGQIGIGGLNSGSGNIGFGNSGTGNVGLFNSGTGNVGFGNSGTANTGFGNAGNVNTGFWNGGSTNTGLANAGAGNTGFFDAGNYNFGSLNAGNINSSFGNSGDGNSGFLNAGDVNSGVGNAGDVNTGLGNSGNINTGGFNPGTLNTGFFSAMTQAGPNSGFFNAGTGNSGFGHNDPAGSGNSGIQNSGFGNSGYVNTSTTSMFGGNSGVLNTGYGNSGFYNAAVNNTGIFVTGVMSSGFFNFGTGNSGLLVSGNGLSGFFKNLFG