Rv1254 Resolved · high auto-curated

H37Rv Rv1254 · MTBC0 mtbc0_001343 · 383 aa · 1410102–1411253 (+) · RefSeq NP_215770.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyltransferase
MTBC0 PGAP re-annotationacyltransferase
Revised (this work)Acyltransferase. Pfam: Acyl_transf_3 (PF01757.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt Q11064 TrEMBL · unreviewed · Predicted
UniProt nameProbable acyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionAcyltransferase
Orthologous groupCOG1835

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.214 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acyl_transf_3PF01757.29 3.3e-2823–371 Acyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: deaD (ATP-dependent RNA helicase DeaD), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1253 deaD ATP-dependent RNA helicase DeaD 884 884 ctx neighborhood:881
Rv3635 transmembrane protein 655 640 ctx cooccurence:627
Rv0227c membrane protein 686 615 ctx cooccurence:601
Rv3906c hyp hypothetical protein 588 589 ctx cooccurence:582
Rv3035 hyp hypothetical protein 588 589 ctx cooccurence:582
Rv1252c lprE lipoprotein LprE 583 584 ctx neighborhood:581
Rv1251c hyp hypothetical protein 550 550 ctx neighborhood:513
Rv0756c hyp hypothetical protein 548 549 ctx cooccurence:545
Rv3810 pirG cell surface protein 538 538 ctx cooccurence:537
Rv3444c esxT ESAT-6 like protein EsxT 507 508 ctx cooccurence:505
Rv1836c hyp hypothetical protein 505 505 ctx cooccurence:502
Rv0111 acyltransferase 491 492 ctx cooccurence:487
Rv2719c chiZ membrane protein 489 489 ctx cooccurence:481
Rv2743c hyp hypothetical protein 469 469 ctx cooccurence:456
Rv1489A hyp hypothetical protein 543 462 ctx cooccurence:459

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyltransferase
  • MTBC0 PGAP product: acyltransferase
  • Pfam (hmmscan --cut_ga): Acyl_transf_3 PF01757.29 (E=3e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215770.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyl_transf_3 (PF01757.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1835
  • Curated reference: UniProt Q11064 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s); context anchor deaD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001343|Rv1254|
MTLPKERAAQGGLERIAHVDRVASLTGIRAVAALLVVGTHAAYTTGKYTHGYWGLMSSRMEIGVPIFFVLSGFLLFRPWVKSAATGGPPPSLSRYAWHRVRRIMPAYTVTVLLAYLVYHFRTAGPNPGHTWVGLFRNLTLTQIYTDGYLGAFLHQGLTQMWSLAVEVAFYLALPALAYLLLVLVCRRRWQPRLLLATMAGLTMISPAWLILVHNTHWMPDGARLWLPTYLAWFVGGMMLAVLAAMGVRCYAFVAIPLAVICYFIVSTPIAGAPTTSPTALAEALVKTAFYAVIAVLAVAPLALGDQGWYAQLLASRPMVFLGEISYEIFLIHLVTMEIAMVDVLGYRVYTSSMVNLCLVTLVLTIPLAWLLHRFTRVQGDRPS