kdpC Family assigned · medium auto-curated
H37Rv Rv1031 · MTBC0 mtbc0_001110 ·
189 aa · 1163190–1163759 (+) ·
RefSeq NP_215547.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | potassium-transporting ATPase subunit C |
|---|---|
| MTBC0 PGAP re-annotation | K(+)-transporting ATPase subunit C |
| Revised (this work) | K(+)-transporting ATPase subunit C. Pfam: KdpC (PF02669.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKF1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Potassium-transporting ATPase KdpC subunit |
| Curated function | Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | kdpC |
| eggNOG description | Part of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP- binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB KdpC ATP ternary complex |
| Orthologous group | COG2156 |
| EC number |
EC 3.6.3.12
|
| KEGG orthology |
K01548
|
| KEGG pathways |
map02020
|
| Gene Ontology (53) |
GO:0003674, GO:0003824, GO:0005215, GO:0005575, GO:0006810, GO:0006811, GO:0006812, GO:0006813, GO:0008150, GO:0008324, GO:0008556, GO:0009987 +41 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.368 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
KdpC | PF02669.21 | 4.5e-74 | 6–187 | K+-transporting ATPase, c chain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: kdpA (potassium-transporting ATPase subunit A), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1029 kdpA |
potassium-transporting ATPase subunit A | 999 | 1000 ctx | neighborhood:881 fusion:817 cooccurence:774 coexpression:843 experimental:895 database:900 textmining:833 |
Rv1030 kdpB |
potassium-transporting ATPase subunit B | 999 | 1000 ctx | neighborhood:882 cooccurence:774 coexpression:865 experimental:837 database:900 textmining:871 |
Rv1028c kdpD |
sensor protein KdpD | 994 | 986 ctx | neighborhood:747 cooccurence:771 coexpression:780 textmining:641 |
Rv1027c kdpE |
transcriptional regulator KdpE | 908 | 846 ctx | neighborhood:747 textmining:434 |
Rv1028A kdpF |
membrane protein KdpF | 917 | 819 ctx | neighborhood:818 textmining:562 |
Rv0900 arfB |
membrane protein | 646 | 46 | textmining:645 |
Rv1604 impA |
inositol-monophosphatase ImpA | 620 | 44 | textmining:619 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: potassium-transporting ATPase subunit C
- MTBC0 PGAP product: K(+)-transporting ATPase subunit C
- Pfam (hmmscan --cut_ga): KdpC PF02669.21 (E=4e-74)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215547.1)
- Domains: Pfam-A via hmmscan --cut_ga — KdpC (PF02669.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2156 - Curated reference: UniProt P9WKF1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
7 functional partner(s); context anchor
kdpA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001110|Rv1031|kdpC MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVLRLNLALDRL