kdpC Family assigned · medium auto-curated

H37Rv Rv1031 · MTBC0 mtbc0_001110 · 189 aa · 1163190–1163759 (+) · RefSeq NP_215547.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)potassium-transporting ATPase subunit C
MTBC0 PGAP re-annotationK(+)-transporting ATPase subunit C
Revised (this work)K(+)-transporting ATPase subunit C. Pfam: KdpC (PF02669.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKF1 SwissProt · reviewed · Evidence at protein level
UniProt namePotassium-transporting ATPase KdpC subunit
Curated functionPart of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB/KdpC/ATP ternary complex.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namekdpC
eggNOG descriptionPart of the high-affinity ATP-driven potassium transport (or Kdp) system, which catalyzes the hydrolysis of ATP coupled with the electrogenic transport of potassium into the cytoplasm. This subunit acts as a catalytic chaperone that increases the ATP- binding affinity of the ATP-hydrolyzing subunit KdpB by the formation of a transient KdpB KdpC ATP ternary complex
Orthologous groupCOG2156
EC number EC 3.6.3.12
KEGG orthology K01548
KEGG pathways map02020
Gene Ontology (53) GO:0003674, GO:0003824, GO:0005215, GO:0005575, GO:0006810, GO:0006811, GO:0006812, GO:0006813, GO:0008150, GO:0008324, GO:0008556, GO:0009987 +41 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.368 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
KdpCPF02669.21 4.5e-746–187 K+-transporting ATPase, c chain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: kdpA (potassium-transporting ATPase subunit A), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1029 kdpA potassium-transporting ATPase subunit A 999 1000 ctx neighborhood:881 fusion:817 cooccurence:774 coexpression:843 experimental:895 database:900 textmining:833
Rv1030 kdpB potassium-transporting ATPase subunit B 999 1000 ctx neighborhood:882 cooccurence:774 coexpression:865 experimental:837 database:900 textmining:871
Rv1028c kdpD sensor protein KdpD 994 986 ctx neighborhood:747 cooccurence:771 coexpression:780 textmining:641
Rv1027c kdpE transcriptional regulator KdpE 908 846 ctx neighborhood:747 textmining:434
Rv1028A kdpF membrane protein KdpF 917 819 ctx neighborhood:818 textmining:562
Rv0900 arfB membrane protein 646 46 textmining:645
Rv1604 impA inositol-monophosphatase ImpA 620 44 textmining:619

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: potassium-transporting ATPase subunit C
  • MTBC0 PGAP product: K(+)-transporting ATPase subunit C
  • Pfam (hmmscan --cut_ga): KdpC PF02669.21 (E=4e-74)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215547.1)
  • Domains: Pfam-A via hmmscan --cut_ga — KdpC (PF02669.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2156
  • Curated reference: UniProt P9WKF1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 7 functional partner(s); context anchor kdpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001110|Rv1031|kdpC
MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAERVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVLRLNLALDRL