Rv0895 Resolved · high auto-curated
H37Rv Rv0895 · MTBC0 - ·
505 aa · 997782–999299 (+) ·
RefSeq NP_215410.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | diacyglycerol O-acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Diacyglycerol O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WKA3
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | Putative diacyglycerol O-acyltransferase Rv0895 |
| EC (curated) |
EC 2.3.1.20
|
| Curated function | Upon expression in E.coli functions very weakly as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Has no wax synthase activity. |
UniProt still lists this protein as Putative diacyglycerol O-acyltransferase Rv0895; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Wax ester synthase-like Acyl-CoA acyltransferase domain |
| Orthologous group | COG1020 |
| EC number |
EC 2.3.1.20
|
| KEGG orthology |
K00635
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00089
|
| Gene Ontology (60) |
GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.375 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
WS_DGAT_cat | PF03007.22 | 2.1e-94 | 32–296 | Wax ester synthase/diacylglycerol acyltransferase catalytic domain |
WS_DGAT_C | PF06974.19 | 3.6e-28 | 341–486 | WS/DGAT C-terminal domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0894 (transcriptional regulator), high confidence from genomic context alone (score 908 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3097c lipY |
triacylglycerol lipase Lip | 921 | 922 | database:900 |
Rv0894 |
transcriptional regulator | 908 | 908 ctx | neighborhood:559 coexpression:801 |
Rv2252 dagK |
diacylglycerol kinase | 900 | 901 | database:900 |
Rv1355c moeY |
molybdopterin biosynthesis protein MoeY | 821 | 822 | coexpression:821 |
Rv1354c hyp |
hypothetical protein | 809 | 809 | coexpression:803 |
Rv1358 |
transcriptional regulator | 806 | 804 | coexpression:803 |
Rv3082c virS |
HTH-type transcriptional regulator VirS | 839 | 783 | coexpression:731 |
Rv1359 |
transcriptional regulator | 866 | 772 | coexpression:772 textmining:437 |
Rv1675c cmr |
HTH-type transcriptional regulator Cmr | 761 | 762 | coexpression:761 |
Rv3391 acrA1 |
acyl-CoA-reductase AcrA | 754 | 744 ctx | cooccurence:729 |
Rv1356c hyp |
hypothetical protein | 744 | 744 | coexpression:744 |
Rv1353c |
HTH-type transcriptional regulator | 740 | 741 | coexpression:740 |
Rv2488c |
LuxR family transcriptional regulator | 737 | 734 | coexpression:733 |
Rv3167c |
TetR family transcriptional regulator | 733 | 734 | coexpression:733 |
Rv2282c |
LysR family HTH-type transcriptional regulator | 733 | 732 | coexpression:731 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): diacyglycerol O-acyltransferase
- Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=2e-94), WS_DGAT_C PF06974.19 (E=4e-28)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215410.1)
- Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WKA3 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
74 functional partner(s); context anchor
Rv0894 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0895| MRQQQEADVVALGRKPGLLCVPERFRAMDLPMAAADALFLWAETPTRPLHVGALAVLSQPDNGTGRYLRKVFSAAVARQQVAPWWRRRPHRSLTSLGQWSWRTETEVDLDYHVRLSALPPRAGTAELWALVSELHAGMLDRSRPLWQVDLIEGLPGGRCAVYVKVHHALADGVSVMRLLQRIVTADPHQRQMPTLWEVPAQASVAKHTAPRGSSRPLTLAKGVLGQARGVPGMVRVVADTTWRAAQCRSGPLTLAAPHTPLNEPIAGARSVAGCSFPIERLRQVAEHADATINDVVLAMCGGALRAYLISRGALPGAPLIAMVPVSLRDTAVIDVFGQGPGNKIGTLMCSLATHLASPVERLSAIRASMRDGKAAIAGRSRNQALAMSALGAAPLALAMALGRVPAPLRPPNVTISNVPGPQGALYWNGARLDALYLLSAPVDGAALNITCSGTNEQITFGLTGCRRAVPALSILTDQLAHELELLVGVSEAGPGTRLRRIAGRR