Rv0895 Resolved · high auto-curated

H37Rv Rv0895 · MTBC0 - · 505 aa · 997782–999299 (+) · RefSeq NP_215410.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diacyglycerol O-acyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Diacyglycerol O-acyltransferase. Pfam: WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WKA3 SwissProt · reviewed · Evidence at transcript level
UniProt namePutative diacyglycerol O-acyltransferase Rv0895
EC (curated) EC 2.3.1.20
Curated functionUpon expression in E.coli functions very weakly as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Has no wax synthase activity.

UniProt still lists this protein as Putative diacyglycerol O-acyltransferase Rv0895; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionWax ester synthase-like Acyl-CoA acyltransferase domain
Orthologous groupCOG1020
EC number EC 2.3.1.20
KEGG orthology K00635
KEGG pathways map00561, map01100
KEGG modules M00089
Gene Ontology (60) GO:0000302, GO:0001666, GO:0003674, GO:0003824, GO:0004144, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0006629, GO:0006638, GO:0006639 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.375 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WS_DGAT_catPF03007.22 2.1e-9432–296 Wax ester synthase/diacylglycerol acyltransferase catalytic domain
WS_DGAT_CPF06974.19 3.6e-28341–486 WS/DGAT C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0894 (transcriptional regulator), high confidence from genomic context alone (score 908 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3097c lipY triacylglycerol lipase Lip 921 922 database:900
Rv0894 transcriptional regulator 908 908 ctx neighborhood:559 coexpression:801
Rv2252 dagK diacylglycerol kinase 900 901 database:900
Rv1355c moeY molybdopterin biosynthesis protein MoeY 821 822 coexpression:821
Rv1354c hyp hypothetical protein 809 809 coexpression:803
Rv1358 transcriptional regulator 806 804 coexpression:803
Rv3082c virS HTH-type transcriptional regulator VirS 839 783 coexpression:731
Rv1359 transcriptional regulator 866 772 coexpression:772 textmining:437
Rv1675c cmr HTH-type transcriptional regulator Cmr 761 762 coexpression:761
Rv3391 acrA1 acyl-CoA-reductase AcrA 754 744 ctx cooccurence:729
Rv1356c hyp hypothetical protein 744 744 coexpression:744
Rv1353c HTH-type transcriptional regulator 740 741 coexpression:740
Rv2488c LuxR family transcriptional regulator 737 734 coexpression:733
Rv3167c TetR family transcriptional regulator 733 734 coexpression:733
Rv2282c LysR family HTH-type transcriptional regulator 733 732 coexpression:731

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): diacyglycerol O-acyltransferase
  • Pfam (hmmscan --cut_ga): WS_DGAT_cat PF03007.22 (E=2e-94), WS_DGAT_C PF06974.19 (E=4e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215410.1)
  • Domains: Pfam-A via hmmscan --cut_ga — WS_DGAT_cat (PF03007.22), WS_DGAT_C (PF06974.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1020
  • Curated reference: UniProt P9WKA3 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 74 functional partner(s); context anchor Rv0894
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0895|
MRQQQEADVVALGRKPGLLCVPERFRAMDLPMAAADALFLWAETPTRPLHVGALAVLSQPDNGTGRYLRKVFSAAVARQQVAPWWRRRPHRSLTSLGQWSWRTETEVDLDYHVRLSALPPRAGTAELWALVSELHAGMLDRSRPLWQVDLIEGLPGGRCAVYVKVHHALADGVSVMRLLQRIVTADPHQRQMPTLWEVPAQASVAKHTAPRGSSRPLTLAKGVLGQARGVPGMVRVVADTTWRAAQCRSGPLTLAAPHTPLNEPIAGARSVAGCSFPIERLRQVAEHADATINDVVLAMCGGALRAYLISRGALPGAPLIAMVPVSLRDTAVIDVFGQGPGNKIGTLMCSLATHLASPVERLSAIRASMRDGKAAIAGRSRNQALAMSALGAAPLALAMALGRVPAPLRPPNVTISNVPGPQGALYWNGARLDALYLLSAPVDGAALNITCSGTNEQITFGLTGCRRAVPALSILTDQLAHELELLVGVSEAGPGTRLRRIAGRR