Rv0891c Family assigned · medium auto-curated
H37Rv Rv0891c · MTBC0 - ·
285 aa · 992598–993455 (-) ·
RefSeq NP_215406.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains Guanylate_cyc (PF00211.26) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WMV1
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized protein Rv0891c |
UniProt still lists this protein as Uncharacterized protein Rv0891c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | regulation of cellular process |
| Orthologous group | COG2114 |
| Gene Ontology (8) |
GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0044424, GO:0044444, GO:0044464
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 5 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Guanylate_cyc | PF00211.26 | 1.1e-07 | 87–218 | Adenylate and Guanylate cyclase catalytic domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0894 (transcriptional regulator), high confidence from genomic context alone (score 965 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0894 |
transcriptional regulator | 965 | 965 ctx | fusion:756 coexpression:801 |
Rv0890c |
HTH-type transcriptional regulator | 921 | 921 ctx | neighborhood:773 cooccurence:513 |
Rv1359 |
transcriptional regulator | 789 | 789 | coexpression:757 |
Rv1120c hyp |
hypothetical protein | 699 | 699 ctx | cooccurence:699 |
Rv0889c citA |
citrate synthase 2 | 547 | 547 ctx | neighborhood:547 |
Rv1675c cmr |
HTH-type transcriptional regulator Cmr | 558 | 544 | |
Rv2079 hyp |
hypothetical protein | 542 | 543 ctx | cooccurence:414 |
Rv2434c |
transmembrane protein | 530 | 515 | |
Rv0104 hyp |
hypothetical protein | 527 | 513 | |
Rv2565 |
NTE family protein | 501 | 482 | |
Rv2561 |
Rv2561, (MTCY9C4.07c), len: 97 aa. Conserved hypothetical protein, highly similar in part (and longer 33 aa) to upstream ORF AAK46951|RV2562 | 464 | 464 ctx | cooccurence:464 |
Rv2423 hyp |
hypothetical protein | 441 | 441 ctx | cooccurence:441 |
Rv1353c |
HTH-type transcriptional regulator | 421 | 421 | |
Rv0339c iniR |
transcriptional regulator | 420 | 420 | |
Rv3166c hyp |
hypothetical protein | 418 | 418 ctx | cooccurence:418 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): Guanylate_cyc PF00211.26 (E=1e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215406.1)
- Domains: Pfam-A via hmmscan --cut_ga — Guanylate_cyc (PF00211.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2114 - Curated reference: UniProt P9WMV1 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
Rv0894 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0891c| MLFNAVHNSLPPNIDIDHAILRGEDHPPTCAKCVARVRISALGSLDLRYHSLRCYAAPPDVGRCEFVPPRRRVLIANQGLDVSRLPPTGTVTLLLADVEESTHLWQMCPEDMATAIAHLDHTVSEAITNHGGVQPVKRYEGDSFVAAFTRASDAAACALDLQRTSLAPIRLRIGLHTGEVQLRDELYVGPTINRTARLRDLAHGGQVVLSAATGDLVTGRLPADAWLVDLGRHPLRGLPRPEWVMQLCHPDIREKFPPLRTAKSSPTSILPAQFTTFVGRRAQIS