lpqS Resolved · high auto-curated

H37Rv Rv0847 · MTBC0 mtbc0_000902 · 130 aa · 947494–947886 (+) · RefSeq NP_215362.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqS
MTBC0 PGAP re-annotationlipoprotein LpqS
Revised (this work)Lipoprotein LpqS. Pfam: LpqS (PF26327.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53859 SwissProt · reviewed · Evidence at transcript level
UniProt nameLipoprotein LpqS
Curated functionMay play an essential role in M.tuberculosis replication and survival inside the host cell.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namelpqS
Orthologous group2BG8G
KEGG orthology K21608
Gene Ontology (6) GO:0008150, GO:0010035, GO:0010038, GO:0042221, GO:0046688, GO:0050896

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.194 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LpqSPF26327.1 9.2e-464–130 Lipoprotein LpqS family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysK2 (cysteine synthase CysK), high confidence from genomic context alone (score 901 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0848 cysK2 cysteine synthase CysK 964 901 ctx neighborhood:512 coexpression:806 textmining:652
Rv0849 MFS-type transporter 969 854 ctx neighborhood:472 coexpression:734 textmining:803
Rv0846c mmcO oxidase 980 853 ctx neighborhood:772 textmining:870
Rv2963 integral membrane protein 974 813 coexpression:813 textmining:870
Rv0850 Rv0850, (MTV043.43), len: 110 aa. Putative transposase (fragment), similar in part to others e.g. Q45144|Q4514 transposable element IS31831 909 553 ctx neighborhood:473 textmining:805
Rv0190 ricR hyp hypothetical protein 883 144 textmining:870
Rv0968 hyp hypothetical protein 429 83 textmining:403
Rv0967 csoR copper-sensing transcriptional repressor CsoR 663 56 textmining:658
Rv2641 cadI cadmium inducible protein CadI 447 55 textmining:439
Rv2643 arsC arsenic-transport integral membrane protein ArsC 517 54 textmining:511
Rv0970 integral membrane protein 418 54 textmining:411
Rv2115c mpa proteasome-associated ATPase 544 47 textmining:542
Rv1946c lppG lipoprotein 531 44 textmining:530
Rv0604 lpqO lipoprotein LpqO 465 44 textmining:464
Rv1049 transcriptional repressor 433 42 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqS
  • MTBC0 PGAP product: lipoprotein LpqS
  • Pfam (hmmscan --cut_ga): LpqS PF26327.1 (E=9e-46)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215362.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LpqS (PF26327.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BG8G
  • Curated reference: UniProt O53859 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor cysK2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000902|Rv0847|lpqS
MVWMRSAIVAVALGVTVAAVAAACWLPQLHRHVAHPNHPLTTSVGSEFVINTDHGHLVDNSMPPCPERLATAVLPRSATPVLLPDVVAAAPGMTAALTDPVAPAARGPPAAQGSVRTGQDLLTRFCLARR