Rv0970 Still unknown · low auto-curated
H37Rv Rv0970 · MTBC0 mtbc0_001036 ·
210 aa · 1088267–1088899 (+) ·
RefSeq NP_215485.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF5134 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF5134. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKL7
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0970 |
UniProt still lists this protein as Uncharacterized protein Rv0970; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF5134) |
| Orthologous group | 2EA7C |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.314 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF5134 | PF17197.10 | 2.5e-41 | 35–206 | Domain of unknown function (DUF5134) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ctpV (copper-exporting ATPase), high confidence from genomic context alone (score 811 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0969 ctpV |
copper-exporting ATPase | 961 | 811 ctx | neighborhood:801 textmining:805 |
Rv0968 hyp |
hypothetical protein | 973 | 804 ctx | neighborhood:794 textmining:870 |
Rv0967 csoR |
copper-sensing transcriptional repressor CsoR | 940 | 564 ctx | neighborhood:538 textmining:870 |
Rv0190 ricR hyp |
hypothetical protein | 451 | 80 | textmining:428 |
Rv0092 ctpA |
cation transporter ATPase A | 451 | 70 | textmining:434 |
Rv0847 lpqS |
lipoprotein LpqS | 418 | 54 | textmining:411 |
Rv2963 |
integral membrane protein | 437 | 52 | textmining:431 |
Rv0846c mmcO |
oxidase | 633 | 50 | textmining:630 |
Rv0988 hyp |
hypothetical protein | 435 | 46 | textmining:433 |
Rv0186A mymT |
metallothionein | 510 | 41 | textmining:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: integral membrane protein
- MTBC0 PGAP product: DUF5134 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF5134 PF17197.10 (E=2e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215485.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF5134 (PF17197.10)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EA7C - Curated reference: UniProt P9WKL7 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
ctpV - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001036|Rv0970| MIHDLMLRWVVTGLFVLTAAECGLAIIAKRRPWTLIVNHGLHFAMAVAMAVMAWPWGARVPTTGPAVFFLLAAVWFGATAVVAVRGTATRGLYGYHGLMMLATAWMYAAMNPRLLPVRSCTEYATEPDGSMPAMDMTAMNMPPNSGSPIWFSAVNWIGTVGFAVAAVFWACRFVMERRQEATQSRLPGSIGQAMMAAGMAMLFFAMLFPV