Rv0970 Still unknown · low auto-curated

H37Rv Rv0970 · MTBC0 mtbc0_001036 · 210 aa · 1088267–1088899 (+) · RefSeq NP_215485.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationDUF5134 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF5134. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKL7 SwissProt · reviewed · Evidence at transcript level
UniProt nameUncharacterized protein Rv0970

UniProt still lists this protein as Uncharacterized protein Rv0970; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF5134)
Orthologous group2EA7C

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.314 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5134PF17197.10 2.5e-4135–206 Domain of unknown function (DUF5134)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ctpV (copper-exporting ATPase), high confidence from genomic context alone (score 811 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0969 ctpV copper-exporting ATPase 961 811 ctx neighborhood:801 textmining:805
Rv0968 hyp hypothetical protein 973 804 ctx neighborhood:794 textmining:870
Rv0967 csoR copper-sensing transcriptional repressor CsoR 940 564 ctx neighborhood:538 textmining:870
Rv0190 ricR hyp hypothetical protein 451 80 textmining:428
Rv0092 ctpA cation transporter ATPase A 451 70 textmining:434
Rv0847 lpqS lipoprotein LpqS 418 54 textmining:411
Rv2963 integral membrane protein 437 52 textmining:431
Rv0846c mmcO oxidase 633 50 textmining:630
Rv0988 hyp hypothetical protein 435 46 textmining:433
Rv0186A mymT metallothionein 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: DUF5134 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF5134 PF17197.10 (E=2e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215485.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5134 (PF17197.10)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EA7C
  • Curated reference: UniProt P9WKL7 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor ctpV
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001036|Rv0970|
MIHDLMLRWVVTGLFVLTAAECGLAIIAKRRPWTLIVNHGLHFAMAVAMAVMAWPWGARVPTTGPAVFFLLAAVWFGATAVVAVRGTATRGLYGYHGLMMLATAWMYAAMNPRLLPVRSCTEYATEPDGSMPAMDMTAMNMPPNSGSPIWFSAVNWIGTVGFAVAAVFWACRFVMERRQEATQSRLPGSIGQAMMAAGMAMLFFAMLFPV