Rv0968 Family assigned · low auto-curated
H37Rv Rv0968 · MTBC0 mtbc0_001034 ·
98 aa · 1085606–1085902 (+) ·
RefSeq NP_215483.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF1490 family protein |
| Revised (this work) | DUF1490 family protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKL9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0968 |
UniProt still lists this protein as Uncharacterized protein Rv0968; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF1490) |
| Orthologous group | 2ET5E |
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.356 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 5.81% of strains (8438) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF1490 | PF07371.18 | 2.0e-37 | 1–90 | Protein of unknown function (DUF1490) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ctpV (copper-exporting ATPase), high confidence from genomic context alone (score 929 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0969 ctpV |
copper-exporting ATPase | 985 | 929 ctx | neighborhood:631 coexpression:815 textmining:804 |
Rv0967 csoR |
copper-sensing transcriptional repressor CsoR | 968 | 845 ctx | neighborhood:647 coexpression:580 textmining:803 |
Rv0970 |
integral membrane protein | 973 | 804 ctx | neighborhood:794 textmining:870 |
Rv0966c hyp |
hypothetical protein | 448 | 448 ctx | neighborhood:448 |
Rv2963 |
integral membrane protein | 460 | 90 | textmining:431 |
Rv0190 ricR hyp |
hypothetical protein | 440 | 88 | textmining:412 |
Rv0847 lpqS |
lipoprotein LpqS | 429 | 83 | textmining:403 |
Rv0846c mmcO |
oxidase | 547 | 55 | textmining:541 |
Rv2952 |
phthiotriol/phenolphthiotriol dimycocerosates methyltransferase | 433 | 41 | textmining:433 |
Rv0186A mymT |
metallothionein | 431 | 41 | textmining:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF1490 family protein
- Pfam (hmmscan --cut_ga): DUF1490 PF07371.18 (E=2e-37)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215483.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF1490 (PF07371.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2ET5E - Curated reference: UniProt P9WKL9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
ctpV - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001034|Rv0968| MVWHGFLAKAVPTVVTGAVGVAAYEALRKMVVKAPLRAATVSVAAWGIRLAREAERKAGESAEQARLMFADVLAEASERAGEEVPPLAVAGSDDGHDH