cmaA1 Resolved · high auto-curated

H37Rv Rv3392c · MTBC0 mtbc0_003604 · 287 aa · 3833013–3833876 (-) · RefSeq NP_217909.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclopropane mycolic acid synthase CmaA
MTBC0 PGAP re-annotationcyclopropane mycolic acid synthase CmaA1
Revised (this work)Cyclopropane mycolic acid synthase CmaA1. Pfam: CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_12 (PF08242.19), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPB7 SwissProt · reviewed · Evidence at protein level
UniProt nameCyclopropane mycolic acid synthase 1
EC (curated) EC 2.1.1.79
Curated functionCatalyzes the conversion of a double bond to a cyclopropane ring at the distal position of an alpha mycolic acid via the transfer of a methylene group from S-adenosyl-L-methionine. Cyclopropanated mycolic acids are key factors participating in cell envelope permeability, host immunomodulation and persistence.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namecmaA1
eggNOG descriptionsynthase
Orthologous groupCOG2230
EC number EC 2.1.1.79
KEGG orthology K00574
Gene Ontology (57) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006629, GO:0006631, GO:0006633, GO:0006732, GO:0006790, GO:0008150 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.148 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.16% of strains (234) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMASPF02353.27 3.2e-1265–283 Mycolic acid cyclopropane synthetase
Methyltransf_23PF13489.13 4.6e-0952–181 Methyltransferase domain
Methyltransf_25PF13649.13 1.6e-1069–162 Methyltransferase domain
Methyltransf_12PF08242.19 3.5e-0869–163 Methyltransferase domain
Methyltransf_11PF08241.19 1.2e-0769–165 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: iunH (nucleoside hydrolase), medium confidence from genomic context alone (score 573 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0449c hyp hypothetical protein 896 891 ctx fusion:867
Rv3393 iunH nucleoside hydrolase 573 573 ctx neighborhood:567
Rv0448c hyp hypothetical protein 491 471
Rv3800c pks13 polyketide synthase 409 108
Rv2172c hyp hypothetical protein 448 64 textmining:435
Rv3254 hyp hypothetical protein 451 61 textmining:440
Rv1523 methyltransferase 529 50 textmining:525
Rv2171 lppM lipoprotein LppM 525 47 textmining:523
Rv0236A hyp hypothetical protein 631 46 textmining:630
Rv3305c amiA1 N-acyl-L-amino acid amidohydrolase AmiA 443 46 textmining:441
Rv3787c S-adenosyl-L-methionine-dependent methyltransferase 630 42 textmining:630

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclopropane mycolic acid synthase CmaA
  • MTBC0 PGAP product: cyclopropane mycolic acid synthase CmaA1
  • Pfam (hmmscan --cut_ga): CMAS PF02353.27 (E=3e-126), Methyltransf_23 PF13489.13 (E=5e-09), Methyltransf_25 PF13649.13 (E=2e-10), Methyltransf_12 PF08242.19 (E=4e-08), Methyltransf_11 PF08241.19 (E=1e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217909.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMAS (PF02353.27), Methyltransf_23 (PF13489.13), Methyltransf_25 (PF13649.13), Methyltransf_12 (PF08242.19), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2230
  • Curated reference: UniProt P9WPB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor iunH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003604|Rv3392c|cmaA1
MPDELKPHFANVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVGLTLSKNQANHVQQLVANSESLRSKRVLLAGWEQFDEPVDRIVSIGAFEHFGHERYDAFFSLAHRLLPADGVMLLHTITGLHPKEIHERGLPMSFTFARFLKFIVTEIFPGGRLPSIPMVQECASANGFTVTRVQSLQPHYAKTLDLWSAALQANKGQAIALQSEEVYERYMKYLTGCAEMFRIGYIDVNQFTCQK