Rv0298 Family assigned · medium auto-curated

H37Rv Rv0298 · MTBC0 mtbc0_000317 · 75 aa · 366591–366818 (+) · RefSeq NP_214812.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin
MTBC0 PGAP re-annotationribbon-helix-helix protein%2C CopG family
Revised (this work)Ribbon-helix-helix protein%2C CopG family. Pfam: RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ09 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin Rv0298
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin Rv0299.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionRibbon-helix-helix protein, copG family
Orthologous group2B37W
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.333 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_1PF01402.28 8.5e-115–42 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0299 (toxin), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0299 toxin 989 887 ctx neighborhood:882 textmining:912
Rv0300 vapB2 antitoxin VapB2 681 681 ctx neighborhood:667
Rv0301 vapC2 ribonuclease VapC2 675 675 ctx neighborhood:667
Rv0297 PE_PGRS5 PE-PGRS family protein PE_PGRS5 499 498 ctx neighborhood:498
Rv0302 transcriptional regulator 426 427 ctx neighborhood:423
Rv0303 dehydrogenase/reductase 421 421 ctx neighborhood:421
Rv0909 antitoxin 630 55 textmining:625
Rv0910 toxin 629 55 textmining:624
Rv3182 higB3 hyp hypothetical protein 657 50 textmining:654
Rv3750c vapB50 excisionase 806 47 textmining:805
Rv3697c vapC48 ribonuclease VapC48 617 47 textmining:615
Rv2018 vapB45 hyp hypothetical protein 450 46 textmining:448
Rv3749c vapC50 hyp hypothetical protein 861 45 textmining:861
Rv2021c higA2 transcriptional regulator 631 44 textmining:630
Rv3183 higA3 transcriptional regulator 630 44 textmining:629

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin
  • MTBC0 PGAP product: ribbon-helix-helix protein%2C CopG family
  • Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=9e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214812.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B37W
  • Curated reference: UniProt P9WJ09 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor Rv0299
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000317|Rv0298|
MTKEKISVTVDAAVLAAIDADARAAGLNRSEMIEQALRNEHLRVALRDYTAKTVPALDIDAYAQRVYQANRAAGS