Rv0236A Still unknown · low auto-curated

H37Rv Rv0236A · MTBC0 - · 57 aa · 286898–287071 (-) · RefSeq YP_177619.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2613. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLB1 SwissProt · reviewed · Evidence at protein level
UniProt namePutative secreted protein Rv0236A

UniProt still lists this protein as Putative secreted protein Rv0236A; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2613)
Orthologous group2A0FU

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2613PF11021.14 3.1e-223–56 Protein of unknown function (DUF2613)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqI (lipoprotein LpqI), high confidence from genomic context alone (score 781 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0237 lpqI lipoprotein LpqI 781 781 ctx neighborhood:778
Rv0236c aftD alpha-(1->3)-arabinofuranosyltransferase 729 729 ctx neighborhood:728
Rv0235c transmembrane protein 597 597 ctx neighborhood:597
Rv0238 transcriptional regulator 521 521 ctx neighborhood:518
Rv0234c gabD1 succinate-semialdehyde dehydrogenase 498 498 ctx neighborhood:496
Rv2171 lppM lipoprotein LppM 805 53 textmining:803
Rv2172c hyp hypothetical protein 806 47 textmining:805
Rv1304 atpB ATP synthase subunit A 544 47 textmining:542
Rv0287 esxG ESAT-6 like protein EsxG 413 47 textmining:410
Rv3392c cmaA1 cyclopropane mycolic acid synthase CmaA 631 46 textmining:630
Rv3019c esxR ESAT-6 like protein EsxR 512 44 textmining:511
Rv0197 oxidoreductase 654 41 textmining:654
Rv3022c PPE48 Rv3021c, (MTV012.35c), len: 358 aa. PPE47, Member of Mycobacterium tuberculosis PPE family. Should be continuation of upstream ORF MTV012.36 510 41 textmining:510
Rv0285 PE5 PE family protein PE5 481 41 textmining:481

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF2613 PF11021.14 (E=3e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177619.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2613 (PF11021.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A0FU
  • Curated reference: UniProt P9WLB1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 62.4, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor lpqI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0236A|
MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSSSVLNRVEYGNRS