Rv3811 Family assigned · medium auto-curated

H37Rv Rv3811 · MTBC0 - · 539 aa · 4274798–4276417 (+) · RefSeq YP_178018.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Rv3811_N (PF27503.1), Amidase_2 (PF01510.31), LGFP (PF08310.18) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79F96 TrEMBL · unreviewed · Inferred from homology
UniProt namePeptidoglycan recognition protein family domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namecsp
eggNOG descriptionN-acetylmuramoyl-L-alanine amidase
Orthologous groupCOG5479

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.452 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 8 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 3.97% of strains (5762) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv3811_NPF27503.1 3.4e-2928–139 Rv3811 N-terminal galactose-binding domain-like
Amidase_2PF01510.31 7.6e-14220–374 N-acetylmuramoyl-L-alanine amidase
LGFPPF08310.18 4.2e-16420–471 LGFP repeat

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pirG (cell surface protein), high confidence from genomic context alone (score 779 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3810 pirG cell surface protein 787 779 ctx neighborhood:714
Rv0207c hyp hypothetical protein 561 561 ctx cooccurence:555
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 553 537
Rv3812 PE_PGRS62 PE-PGRS family protein PE_PGRS62 536 536 ctx neighborhood:536
Rv3492c Mce associated protein 472 472
Rv3808c glfT2 galactofuranosyl transferase GlfT 466 466
Rv3668c protease 458 458 ctx cooccurence:458
Rv3809c glf UDP-galactopyranose mutase 466 447 ctx neighborhood:422
Rv1363c membrane protein 423 423
Rv3268 hyp hypothetical protein 416 414
Rv1972 Mce associated membrane protein 404 405
Rv3802c membrane protein 400 400
Rv0050 ponA1 bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase 459 351
Rv3707c hyp hypothetical protein 515 258
Rv3594 hyp hypothetical protein 920 179 textmining:907

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv3811_N PF27503.1 (E=3e-29), Amidase_2 PF01510.31 (E=8e-14), LGFP PF08310.18 (E=4e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178018.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv3811_N (PF27503.1), Amidase_2 (PF01510.31), LGFP (PF08310.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5479
  • Curated reference: UniProt Q79F96 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor pirG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3811|
MAATVVIVAWIANRPPASSHEPSPTPNTQLAEQPLIGLGGGVTVRELTQDTPFSLVALTGDLAGTSARVRAKRPDGDWGPWYQTEYETEPRDPAGTDGSVELGGLNPGPRSTDPVFVGTTTTVQVAVTRPIDAPITQPPAGRPPNDLLDSGLGYRPATKEQPFGQNISAILISPPQAPPGTQWTPPTAVTMAGQPPAIISRAEWGADESLRCETPEYDRGVRAAVVHHTAGSNDYSPLESAGIVKAIYTYHSKTLGWCDIAYNALVDKYGQVFEGSAGGLTKPVEGFHTGGFNRNTWGVAMIGNFDDVAPTPIQIRTVGRLLGWRLGMDDVDPRSMVDLQSAGSSYTTFPGGAIARLPAIFTHRDVGNTDCPGNAAYAVMDEIRDIAAHFNDPPEELIKALEGGAIYQRWQALGGMNSALGAPTSPEADAADGARYATFAKGAMYWSPVTDAQPITGAIYEAWASQSYERGPLGLPTSAEIQEPLQITQNFQHGTLNFERLTGNVTEVVDGITTPLATRPPSGPTVPPEHFTLPTHPIT