espL Resolved · high auto-curated

H37Rv Rv3880c · MTBC0 mtbc0_004114 · 115 aa · 4384445–4384792 (-) · RefSeq NP_218397.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspL
MTBC0 PGAP re-annotationtype VII secretion system ESX-1 associated protein EspL
Revised (this work)Type VII secretion system ESX-1 associated protein EspL. Pfam: YbaB_DNA_bd (PF02575.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJB9 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspL
Curated functionProbably plays a role in host phagosome maturation arrest.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionBinds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection
Orthologous group2B0QF
Gene Ontology (56) GO:0002682, GO:0002683, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0030312, GO:0031347 +44 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.98 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
YbaB_DNA_bdPF02575.22 6.8e-1217–102 YbaB/EbfC DNA-binding family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: espB (ESX-1 secretion-associated protein EspB), high confidence from genomic context alone (score 978 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3881c espB ESX-1 secretion-associated protein EspB 995 978 ctx neighborhood:882 coexpression:822 textmining:817
Rv3882c eccE1 ESX-1 secretion system protein EccE1 889 766 ctx neighborhood:763 textmining:547
Rv3715c recR recombination protein RecR 776 748 coexpression:734
Rv3883c mycP1 membrane-anchored mycosin 824 653 ctx neighborhood:648 textmining:514
Rv3614c espD ESX-1 secretion-associated protein EspD 648 503 experimental:500
Rv1307 atpH ATP synthase subunit b/delta 463 464 coexpression:448
Rv3721c dnaZX DNA polymerase III subunit gamma/tau 498 451 coexpression:432
Rv3644c DNA polymerase 489 441 coexpression:422
Rv2842c rimP ribosome maturation factor RimP 440 441 coexpression:422
Rv3443c rplM 50S ribosomal protein L13 434 435 coexpression:417
Rv0652 rplL 50S ribosomal protein L7/L12 429 429 coexpression:411
Rv1901 cinA competence damage-inducible protein CinA 411 410
Rv2461c clpP1 ATP-dependent CLP protease proteolytic subunit 1 417 395
Rv2460c clpP2 ATP-dependent CLP protease proteolytic subunit 2 407 386
Rv3867 espH ESX-1 secretion-associated protein EspH 853 288 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspL
  • MTBC0 PGAP product: type VII secretion system ESX-1 associated protein EspL
  • Pfam (hmmscan --cut_ga): YbaB_DNA_bd PF02575.22 (E=7e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218397.1)
  • Domains: Pfam-A via hmmscan --cut_ga — YbaB_DNA_bd (PF02575.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B0QF
  • Curated reference: UniProt P9WJB9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor espB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004114|Rv3880c|espL
MSMDELDPHVARALTLAARFQSALDGTLNQMNNGSFRATDEAETVEVTINGHQWLTGLRIEDGLLKKLGAEAVAQRVNEALHNAQAAASAYNDAAGEQLTAALSAMSRAMNEGMA