PPE58 Family assigned · medium auto-curated

H37Rv Rv3426 · MTBC0 - · 232 aa · 3843036–3843734 (+) · RefSeq YP_177972.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PPE family protein PPE58
MTBC0 PGAP re-annotation
Revised (this work)PPE family protein PPE58. Pfam: PPE (PF00823.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q50702 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized PPE family protein PPE58

UniProt still lists this protein as Uncharacterized PPE family protein PPE58; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
eggNOG descriptionPPE family
Orthologous groupCOG5651
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.267 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 70.24% of strains (101996) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PPEPF00823.26 1.3e-381–126 PPE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE57 (PPE family protein PPE57), high confidence from genomic context alone (score 915 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3425 PPE57 PPE family protein PPE57 919 915 ctx neighborhood:418 coexpression:860
Rv3429 PPE59 PPE family protein PPE59 742 730 coexpression:730
Rv3159c PPE53 PPE family protein PPE53 533 86 textmining:511
Rv3738c PPE66 PPE family protein PPE66 444 55 textmining:436
Rv0305c PPE6 PPE family protein PPE6 443 50 textmining:438
Rv0619 galTb Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly 439 46 textmining:437
Rv0805 cpdA 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA 438 44 textmining:437
Rv0354c PPE7 PPE family protein PPE7 408 44 textmining:407
Rv1899c lppD lipoprotein LppD 758 42 textmining:758
Rv0311 hyp hypothetical protein 545 42 textmining:545
Rv1267c embR transcriptional regulator EmbR 433 42 textmining:433
Rv1087 PE_PGRS21 PE-PGRS family protein PE_PGRS21 870 41 textmining:870
Rv1067c PE_PGRS19 PE-PGRS family protein PE_PGRS19 805 41 textmining:805
Rv0278c PE_PGRS3 PE-PGRS family protein PE_PGRS3 803 41 textmining:803
Rv0747 PE_PGRS10 PE-PGRS family protein PE_PGRS10 728 41 textmining:728

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE58
  • Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=1e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177972.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5651
  • Curated reference: UniProt Q50702 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor PPE57
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3426|PPE58
MHLMIPAEYISNVIYEGPRADSLYAADQRLRQLADSVRTTAESLNTTLDELHENWKGSSSEWMADAALRYLDWLSKHSRQILRTARVIESLVMAYEETLLRVVPPATIANNREEVRRLIASNVAGGKHSSNRRPRGTIRAVPGRKYPSNGPLSKLDPICAIEAAPMAGAAADPQERVGPRGRRGLAGQQQCRGRPGPSLRCSHDTPRFQMNQAFHTMVNMLLTCFACQEKPR