PE_PGRS10 Family assigned · medium auto-curated

H37Rv Rv0747 · MTBC0 - · 801 aa · 838451–840856 (+) · RefSeq YP_177751.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE-PGRS family protein PE_PGRS10
MTBC0 PGAP re-annotation
Revised (this work)PE-PGRS family protein PE_PGRS10. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WIG1 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized PE-PGRS family protein PE_PGRS10

UniProt still lists this protein as Uncharacterized PE-PGRS family protein PE_PGRS10; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
O Post-translational modification, protein turnover, chaperones
eggNOG descriptionamine dehydrogenase activity
Orthologous groupCOG3391

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.485 · purifying
Polymorphic sites (≥ 0.1% of strains) 11 synonymous, 13 missense, 0 nonsense, 6 frameshift
Disruption 6 distinct premature-stop/frameshift site(s); most common in 0.30% of strains (441) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 6.6e-314–94 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB31 (antitoxin VapB31), medium confidence from genomic context alone (score 538 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0748 vapB31 antitoxin VapB31 538 538 ctx neighborhood:538
Rv0749 vapC31 ribonuclease VapC31 490 490 ctx neighborhood:490
Rv0198c zmp1 zinc metalloprotease 407 407
Rv0931c pknD serine/threonine-protein kinase PknD 434 210
Rv1899c lppD lipoprotein LppD 659 43 textmining:659
Rv0311 hyp hypothetical protein 517 43 textmining:516
Rv1175c fadH NADPH dependent 2,4-dienoyl-CoA reductase FadH 440 43 textmining:439
Rv0805 cpdA 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA 433 42 textmining:433
Rv3426 PPE58 PPE family protein PPE58 728 41 textmining:728
Rv3344c PE_PGRS49 PE-PGRS family protein PE_PGRS49 630 41 textmining:630
Rv1361c PPE19 PPE family protein PPE19 511 41 textmining:511
Rv3159c PPE53 PPE family protein PPE53 440 41 textmining:440
Rv2544 lppB lipoprotein LppB 440 41 textmining:440
Rv2543 lppA lipoprotein LppA 438 41 textmining:438
Rv2178c aroG phospho-2-dehydro-3-deoxyheptonate aldolase AroG 432 41 textmining:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS10
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=7e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177751.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3391
  • Curated reference: UniProt P9WIG1 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor vapB31
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0747|PE_PGRS10
MSWVMVSPELVVAAAADLAGIGSAISSANAAAAVNTTGLLTAGADEVSTAIAALFGAQGQAYQAASAQAAAFYAQFVQALSAGGGAYAAAEAAAVSPLLAPINAQFVAATGRPLIGNGANGAPGTGANGGPGGWLIGNGGAGGSGAPGAGAGGNGGAGGLFGSGGAGGASTDVAGGAGGAGGAGGNAGMLFGAAGVGGVGGFSNGGATGGAGGAGGAGGLFGAGRERGSGGSGNLTGGAGGAGGNAGTLATGDGGAGGTGGASRSGGFGGAGGAGGDAGMFFGSGGSGGAGGISKSVGDSAAGGAGGAPGLIGNGGNGGNGGASTGGGDGGPGGAGGTGVLIGNGGNGGSGGTGATLGKAGIGGTGGVLLGLDGFTAPASTSPLHTLQQDVINMVNDPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGQGTIGGVNGGAGGAGGAGGILFGTGGTGGSGGPGATGLGGIGGAGGAALLFGSGGAGGSGGAGAVGGNGGAGGNAGALLGAAGAGGAGGAGAVGGNGGAGGNGGLFANGGAGGPGGFGSPAGAGGIGGAGGNGGLFGAGGTGGAGGGSTLAGGAGGAGGNGGLFGAGGTGGAGSHSTAAGVSGGAGGAGGDAGLLSLGASGGAGGSGGSSLTAAGVVGGIGGAGGLLFGSGGAGGSGGFSNSGNGGAGGAGGDAGLLVGSGGAGGAGASATGAATGGDGGAGGKSGAFGLGGDGGAGGATGLSGAFHIGGKGGVGGSAVLIGNGGNGGNGGNSGNAGKSGGAPGPSGAGGAGGLLLGENGLNGLM