PE_PGRS21 Family assigned · medium auto-curated

H37Rv Rv1087 · MTBC0 - · 767 aa · 1211560–1213863 (+) · RefSeq YP_177783.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE-PGRS family protein PE_PGRS21
MTBC0 PGAP re-annotation
Revised (this work)PE-PGRS family protein PE_PGRS21. Pfam: PE (PF00934.26), PGRS (PF21526.3).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FT0 TrEMBL · unreviewed · Predicted
UniProt namePE-PGRS family protein PE_PGRS21

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionPE-PGRS family
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.515 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 10 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.11% of strains (161) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 4.6e-354–94 PE family
PGRSPF21526.3 7.2e-15122–190 PGRS repeats

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1086 ((2Z,6E)-farnesyl diphosphate synthase), medium confidence from genomic context alone (score 457 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1086 (2Z,6E)-farnesyl diphosphate synthase 457 457 ctx neighborhood:457
Rv1087A Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT 457 457 ctx neighborhood:457
Rv0198c zmp1 zinc metalloprotease 407 407
Rv0931c pknD serine/threonine-protein kinase PknD 532 210 textmining:432
Rv1899c lppD lipoprotein LppD 862 43 textmining:862
Rv0805 cpdA 3',5'-cyclic adenosine monophosphate phosphodiesterase CpdA 643 42 textmining:643
Rv3426 PPE58 PPE family protein PPE58 870 41 textmining:870
Rv3344c PE_PGRS49 PE-PGRS family protein PE_PGRS49 804 41 textmining:804
Rv0311 hyp hypothetical protein 726 41 textmining:726
Rv3159c PPE53 PPE family protein PPE53 655 41 textmining:655
Rv0619 galTb Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly 641 41 textmining:641
Rv1267c embR transcriptional regulator EmbR 625 41 textmining:625
Rv1753c PPE24 PPE family protein PPE24 529 41 textmining:529

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS21
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=5e-35), PGRS PF21526.3 (E=7e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177783.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26), PGRS (PF21526.3)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt Q79FT0 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv1086
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1087|PE_PGRS21
MSFVVVAPEVLAAAASDLAGIGSTLAQANAAALAPTTAVLAAGADEVSAAIASLFGAHGQAYQAVSAQMSAFHAQFMQALTGAGGAYAAAEAVNVSAAQSVEQDLLAAINARFERIFGRPLIGDGANGGPGQDGGPGGLLYGNGGNGGTSTTVGMAGGNGGAAGLIGNGGFGGGGGPGAAGGNGGAGGWLFGNGGAGGAGGLGVAPGVPGGAGGAGGAGGVGGPAGLWGHGGAGGAGGAGVAGAGGFEGTIGAGGAGGVGGAGGVGGAGGAGGWLYGDAGAGGDGGVGGAGGTGGLGNRGGAGGAGGAGGVGGAGGAAGLWGGGGAGGVGGTGGGAGLGAQSVTFSSSLSGLSGGDGGAGGAGGAGGAGGTGGWLYGGGGAAGSGGDGGTGGQGGAGGAGVFSLFGSGGGPGGNGGVGGVGGVGGAGGRAGLFGVGGLGGAGGDAGDSGEGGFGGPGLAGGLFGNPGNGGVGGIGGDAAAGGAGGAGGNGGAGGNGGWLFGNGGAGGSGGDGGAAGRGGAGNLGSAGGINAPAGNPGSGSVGIGGAGGAGGTAGLFGDGGAGGAGGAGAAGGFGGISAATPSAGSEGAMGGAGGVGGNARLLGTGGAGGVGGGGGAGGDGGRGGVATPGGQGGDAGDGGAGGAGGNGGGASGAGGWLLGTGGAGGAGGNGGNGGKAGFSPGPTNFGLNGAGGGGGVGGNGATGPWLFGDGGPTPGSTGAGAAGGHGGDAQLIGNGGHGGAGGTGVPNGSGGAGGLSGLLFGEPGANG