PPE6 Family assigned · medium auto-curated

H37Rv Rv0305c · MTBC0 - · 963 aa · 372820–375711 H37Rv (-) · RefSeq YP_177715.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PPE family protein PPE6
MTBC0 PGAP re-annotation
Revised (this work)PPE family protein PPE6. Pfam: PPE (PF00823.26), Pentapeptide_2 (PF01469.25).
Functional category (TubercuList)PE/PPE

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder100% of residues (metapredict) · mean AlphaFold pLDDT 78.2
Disordered regions1 IDR(s), longest 963 aa [0-963]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 1.96 (95% CI -0.04 to 5.70). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0313c · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt Q6MX48 TrEMBL · unreviewed · Inferred from homology
UniProt namePPE family protein PPE6

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
eggNOG descriptionPentapeptide repeats (8 copies)
Orthologous groupCOG5651

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.75 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 17 missense, 1 nonsense, 4 frameshift
Disruption 5 distinct premature-stop/frameshift site(s); most common in 96.71% of strains (140430) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 17/53 (32%) · mean identity 54.0% · 3/4 closest MTBAP relatives
present in a subset of the genus (17/53 NTM; in 3 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 61 in the ORF — 0 in the essential state, 0 growth-defect, 61 non-essential, 0 growth-advantage. Saturation 0.951, mean read count 137.775862069. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 2 of 16 independent MS datasets
Integrated abundance0.23 ppm · rank 3425/3519 (2.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length963 aa
Molecular weight99.0 kDa
Theoretical pI9.39
GRAVY-0.203 (hydrophilic)
Aliphatic index68.6
Aromaticity0.093
Instability index23.4 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PPEPF00823.26 1.7e-602–165 PPE family
Pentapeptide_2PF01469.25 3.8e-11771–808 Pentapeptide repeats (8 copies)

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 78.2

PDB hitprobTM-scoreE-valueDescription
5xfs-assembly1_B 1.00 0.92 3.1e-10 sig 5xfs-assembly1_B Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
4w4l-assembly1_B 1.00 0.91 5.9e-08 sig 4w4l-assembly1_B Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis
6vj5-assembly1_B 1.00 0.91 1.8e-07 sig 6vj5-assembly1_B Structure of PE25-PPE41(A124L) in complex with EspG5 chaperone from the type VII (ESX-5) secretion system
6uuj-assembly2_E 1.00 0.82 1.3e-06 sig 6uuj-assembly2_E Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121
6uuj-assembly3_H 1.00 0.81 1.3e-06 sig 6uuj-assembly3_H Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group P212121

Foldseek search of the AlphaFold DB model (mean pLDDT 78.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)PPE5 (- strand, 55 bp gap)
Downstream (3' on genome)Rv0306 (+ strand, 202 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: PPE5 (PPE family protein PPE5), high confidence from genomic context alone (score 947 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0304c PPE5 PPE family protein PPE5 950 947 ctx neighborhood:618 coexpression:853
Rv0355c PPE8 PPE family protein PPE8 791 790 coexpression:770
Rv3533c PPE62 PPE family protein PPE62 784 785 coexpression:761
Rv3903c cpnT hyp hypothetical protein 782 782 ctx cooccurence:755
Rv1548c PPE21 PPE family protein PPE21 776 776 coexpression:730
Rv2082 hyp hypothetical protein 775 776 ctx cooccurence:773
Rv1004c membrane protein 774 775 ctx cooccurence:774
Rv2209 integral membrane protein 774 774 ctx cooccurence:773
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 774 774 ctx cooccurence:774
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 773 773 ctx cooccurence:773
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 773 773 ctx cooccurence:773
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 773 773 ctx cooccurence:773
Rv1243c PE_PGRS23 PE-PGRS family protein PE_PGRS23 773 773 ctx cooccurence:773
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 773 773 ctx cooccurence:773
Rv0124 PE_PGRS2 PE-PGRS family protein PE_PGRS2 773 773 ctx cooccurence:773

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE6
  • Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=2e-60), Pentapeptide_2 PF01469.25 (E=4e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177715.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), Pentapeptide_2 (PF01469.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5651
  • Curated reference: UniProt Q6MX48 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 78.2)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 122 functional partner(s); context anchor PPE5
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0305c|PPE6
MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWFGSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAATVHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVSALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGFGNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIGFGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDVNTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGNYSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTSIVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFGNSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGNTISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANLGDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGLTGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFGIGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDLQHRHGEHRQYQHRRFHLRQPQQRPSVAGRQPGSDRPRHRRRHSRNPDCERRREYPDSHTDHRQLHGHRIQRARSSTEHSRHCYFFRTRRYRPLHRPSDTDNRSHTCGHGGWTHYRDQYRRHCGRRRHQHPDYPYSSDSRLRQLDRRTVVGLLQ