Rv2012 Family assigned · low auto-curated · to review

H37Rv Rv2012 · MTBC0 - · 164 aa · 2259326–2259820 (+) · RefSeq NP_216528.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 2hh8-assembly1_A Solution NMR structure of the ydfO protein from Escherichia col (prob 1.00, TM 0.74). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WLM3 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv2012

UniProt still lists this protein as Uncharacterized protein Rv2012; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF1398)
Orthologous groupCOG5562

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.509 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1398PF07166.17 7.4e-0944–147 Protein of unknown function (DUF1398)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 76.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2hh8-assembly1_A 1.00 0.74 1.9e-05 sig 2hh8-assembly1_A Solution NMR structure of the ydfO protein from Escherichia coli. Northeast Structural Genomics target ER251.
4qt6-assembly1_A 0.15 0.64 2.0e+00 4qt6-assembly1_A Crystal structure of the SPRY domain of human HERC1
6qh1-assembly1_A 0.06 0.22 4.5e-01 6qh1-assembly1_A The structure of Schizosaccharomyces pombe PCNA in complex with an Spd1 derived peptide
6qh1-assembly1_B 0.06 0.24 5.5e-01 6qh1-assembly1_B The structure of Schizosaccharomyces pombe PCNA in complex with an Spd1 derived peptide
3b8b-assembly1_A 0.06 0.48 5.1e+00 3b8b-assembly1_A Crystal structure of CysQ from Bacteroides thetaiotaomicron, a bacterial member of the inositol monophosphatase family
8p9o-assembly1_A 0.05 0.24 1.0e+00 8p9o-assembly1_A PCNA from Chaetomium thermophilum in complex with PolD3 peptide
2zvv-assembly2_B 0.05 0.25 7.9e-01 2zvv-assembly2_B Crystal structure of Proliferating cellular nuclear antigen 1 and Short peptide from human P21
6oaq-assembly1_B 0.05 0.23 9.6e-01 6oaq-assembly1_B Crystal structure of a dual sensor histidine kinase in BeF3- bound state

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2011c hyp hypothetical protein 598 598 ctx neighborhood:587
Rv0991c hyp hypothetical protein 553 55 textmining:547
Rv0990c hyp hypothetical protein 801 49 textmining:800
Rv3224 iron-regulated short-chain dehydrogenase/reductase 809 42 textmining:809
Rv3729 transferase 803 42 textmining:803
Rv2541 hyp hypothetical protein 803 41 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DUF1398 PF07166.17 (E=7e-09)
  • Foldseek best: 2hh8-assembly1_A Solution NMR structure of the ydfO protein from Escherichia col (prob 1.00, E=2e-05, TM=0.74)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216528.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1398 (PF07166.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5562
  • Curated reference: UniProt P9WLM3 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 76.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2012|
MLSKSKRSCRRRETLRIGEKMSAPITNLQAAQRDAIMNRPAVNGFPHLAETLRRAGVRTNTWWLPAMQSLYETDYGPVLDQGVPLIDGVAEVPAFDRTALVTALRADQAGQTSFREFAAAAWRAGVLRYVVDLENRTCTYFGLHDQTYMEHYAAVEPSGGAPTS