Rv1824 Family assigned · low auto-curated

H37Rv Rv1824 · MTBC0 mtbc0_001938 · 121 aa · 2088742–2089107 (+) · RefSeq NP_216340.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationsmall basic family protein
Revised (this work)Small basic family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLR7 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized protein Rv1824

UniProt still lists this protein as Uncharacterized protein Rv1824; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namesbp
eggNOG descriptionProtein of unknown function (DUF1290)
Orthologous groupCOG3856

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1290PF06947.18 6.3e-3432–119 Protein of unknown function (DUF1290)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pgsA2 (CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase), high confidence from genomic context alone (score 841 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1823 hyp hypothetical protein 992 992 ctx neighborhood:839 cooccurence:774 coexpression:797
Rv1825 hyp hypothetical protein 979 978 ctx neighborhood:861 cooccurence:774
Rv1822 pgsA2 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 841 841 ctx neighborhood:839
Rv0012 membrane protein 840 834 ctx cooccurence:774
Rv1826 gcvH glycine cleavage system protein H 819 820 ctx neighborhood:810
Rv1821 secA2 accessory Sec system translocase SecA2 724 724 ctx neighborhood:714
Rv1820 ilvG acetolactate synthase large subunit IlvG 708 708 ctx neighborhood:707
Rv1828 HTH-type transcriptional regulator 696 696 ctx neighborhood:692
Rv1827 garA glycogen accumulation regulator GarA 696 696 ctx neighborhood:692
Rv1829 hyp hypothetical protein 640 641 ctx neighborhood:632
Rv1819c bacA vitamin B12 transport ATP-binding protein BacA 551 552 ctx neighborhood:548
Rv1629 polA DNA polymerase I 478 479 coexpression:403
Rv3261 fbiA 2-phospho-L-lactate transferase 441 441 coexpression:441
Rv2375 hyp hypothetical protein 436 436 ctx cooccurence:434
Rv1009 rpfB resuscitation-promoting factor RpfB 421 421 ctx cooccurence:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: small basic family protein
  • Pfam (hmmscan --cut_ga): DUF1290 PF06947.18 (E=6e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216340.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1290 (PF06947.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3856
  • Curated reference: UniProt P9WLR7 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor pgsA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001938|Rv1824|
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLERIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFGA