pgsA2 Family assigned · medium auto-curated

H37Rv Rv1822 · MTBC0 mtbc0_001936 · 209 aa · 2087168–2087797 (+) · RefSeq NP_216338.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
MTBC0 PGAP re-annotationCDP-alcohol phosphatidyltransferase family protein
Revised (this work)CDP-alcohol phosphatidyltransferase family protein. Pfam: CDP-OH_P_transf (PF01066.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPG5 SwissProt · reviewed · Evidence at protein level
UniProt namePutative cardiolipin synthase
EC (curated) EC 2.7.8.41
Curated functionMay catalyze the biosynthesis of cardiolipin from phosphatidylglycerol (PG) and CDP-diacylglycerol. May also catalyze the synthesis of phosphatidylinositol.

UniProt still lists this protein as Putative cardiolipin synthase; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namepgsA2
eggNOG descriptionCDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase
Orthologous groupCOG0558
EC number EC 2.7.8.41, EC 2.7.8.5
KEGG orthology K00995, K08744
KEGG pathways map00564, map01100
Gene Ontology (29) GO:0003674, GO:0003824, GO:0006629, GO:0006644, GO:0006650, GO:0006793, GO:0006796, GO:0008150, GO:0008152, GO:0008444, GO:0008610, GO:0008654 +17 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.233 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CDP-OH_P_transfPF01066.27 6.1e-3612–167 CDP-alcohol phosphatidyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gcvH (glycine cleavage system protein H), high confidence from genomic context alone (score 794 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2746c pgsA3 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase 933 928 database:900
Rv0436c pssA CDP-diacylglycerol--serine O-phosphatidyltransferase 972 921 database:900 textmining:672
Rv2612c pgsA1 CDP-diacylglycerol--inositol 3-phosphatidyltransferase 981 914 database:900 textmining:793
Rv2881c cdsA phosphatidate cytidylyltransferase 931 904 database:900
Rv2289 cdh CDP-diacylglycerol pyrophosphatase 901 901 database:900
Rv2350c plcB membrane-associated phospholipase B 900 901 database:900
Rv2349c plcC phospholipase C 900 900 database:900
Rv1755c plcD Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o 900 900 database:900
Rv2351c plcA membrane-associated phospholipase A 900 900 database:900
Rv1823 hyp hypothetical protein 883 883 ctx neighborhood:882
Rv1824 hyp hypothetical protein 841 841 ctx neighborhood:839
Rv1825 hyp hypothetical protein 824 825 ctx neighborhood:822
Rv1826 gcvH glycine cleavage system protein H 794 794 ctx neighborhood:778
Rv1901 cinA competence damage-inducible protein CinA 823 769 coexpression:736
Rv1821 secA2 accessory Sec system translocase SecA2 752 738 ctx neighborhood:736

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  • MTBC0 PGAP product: CDP-alcohol phosphatidyltransferase family protein
  • Pfam (hmmscan --cut_ga): CDP-OH_P_transf PF01066.27 (E=6e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216338.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CDP-OH_P_transf (PF01066.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0558
  • Curated reference: UniProt P9WPG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor gcvH
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001936|Rv1822|pgsA2
MEPVLTQNRVLTVPNMLSVIRLALIPAFVYVVLSAHANGWGVAILVFSGVSDWADGKIARLLNQSSRLGALLDPAVDRLYMVTVPIVFGLSGIVPWWFVLTLLTRDALLAGTLPLLWSRGLSALPVTYVGKAATFGFMVGFPTILLGQCDPLWSHVLLACGWAFLIWGMYAYLWAFVLYAVQMTMVVRQMPKLKGRAHRPAAQNAGERG