Rv1835c Family assigned · medium auto-curated

H37Rv Rv1835c · MTBC0 mtbc0_001948 · 628 aa · 2098733–2100619 MTBC0 (-) · RefSeq NP_216351.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)serine esterase
MTBC0 PGAP re-annotationCocE/NonD family hydrolase
Revised (this work)CocE/NonD family hydrolase. Pfam: Peptidase_S15 (PF02129.25), PepX_C (PF08530.17).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.10 (95% CI -0.38 to 3.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser functionFunction unknown

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (EC number). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1866c · 100.0% identity
M. orygis RJtmp_001903 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WIQ9 SwissProt · reviewed · Evidence at protein level
UniProt namePutative serine esterase Rv1835c
EC (curated) EC 3.1.1.-

UniProt still lists this protein as Putative serine esterase Rv1835c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionpeptidase S15
Orthologous groupCOG2936
KEGG orthology K06978
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.617 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 7 synonymous, 13 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 1.18% of strains (1710) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.212 · 20 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.212) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 2/53 (4%) · mean identity 79.5% · 0/4 closest MTBAP relatives
absent from the closest MTBAP relatives and nearly all NTM (2/53) — a strong MTBC-restricted candidate (possible host-adaptation innovation, confirm by synteny)
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 42 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 30 growth-advantage. Saturation 1.000, mean read count 259.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call

Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (CocE/NonD family hydrolase. Pfam: Peptidase_S15 (PF02129.25), PepX_C (PF08530.17), which was derived independently from structure and orthology.

Source annotationRv1835c Putative serine esterase Rv1835c (conserved hypotheticals)
Covalent-inhibitor competition20.0× (probe labelling blocked by a serine-hydrolase inhibitor)

experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance9.25 ppm · rank 2719/3519 (22.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length628 aa
Molecular weight69.9 kDa
Theoretical pI7.36
GRAVY-0.346 (hydrophilic)
Aliphatic index78.6
Aromaticity0.107
Instability index39.8 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_S15PF02129.25 8.3e-5238–351 X-Pro dipeptidyl-peptidase (S15 family)
PepX_CPF08530.17 7.7e-39387–602 X-Pro dipeptidyl-peptidase C-terminal non-catalytic domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.6

PDB hitprobTM-scoreE-valueDescription
3i2j-assembly1_A 1.00 0.75 2.8e-44 sig 3i2j-assembly1_A Cocaine Esterase, wild type, without a ligand
1l7q-assembly1_A 1.00 0.76 2.3e-42 sig 1l7q-assembly1_A Ser117Ala Mutant of Bacterial Cocaine Esterase cocE
9k48-assembly1_A 1.00 0.74 2.6e-43 sig 9k48-assembly1_A Bacetrial Cocaine Esterase with mutations T172R/G173Q/V116K/S117A/A51K
3pui-assembly1_A 1.00 0.73 2.2e-43 sig 3pui-assembly1_A Cocaine Esterase with mutations G4C, S10C
3i2g-assembly1_A 1.00 0.75 4.5e-43 sig 3i2g-assembly1_A Cocaine Esterase with mutation G173Q, bound to DTT adduct

Foldseek search of the AlphaFold DB model (mean pLDDT 93.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)lipZ (+ strand, 4 bp gap)
Downstream (3' on genome)Rv1836c (- strand, 15 bp gap)
Predicted operon Rv1835c · Rv1836c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv1990c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: glcB (malate synthase), medium confidence from genomic context alone (score 496 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1836c hyp hypothetical protein 780 779 ctx neighborhood:772
Rv1837c glcB malate synthase 496 496 ctx neighborhood:491
Rv3510c hyp hypothetical protein 455 233
Rv2334 cysK1 O-acetylserine sulfhydrylase 421 55 textmining:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: serine esterase
  • MTBC0 PGAP product: CocE/NonD family hydrolase
  • Pfam (hmmscan --cut_ga): Peptidase_S15 PF02129.25 (E=8e-52), PepX_C PF08530.17 (E=8e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216351.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_S15 (PF02129.25), PepX_C (PF08530.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2936
  • Curated reference: UniProt P9WIQ9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor glcB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001948|Rv1835c|
MTRRGGSDAAWYSAPDQRSAYPRYRGMRYSSCYVTMRDGVRIAIDLYLPAGLTSAARLPAILHQTRYYRSLQLRWPLRMLLGGKPLQHIAADKRRRRRFVASGYAWVDVDVRGSGASFGARVCEWSSDEIRDGAEIVDWIVRQPWCNGTVAALGNSYDGTSAELLLVNQHPAVRVIAPCFSLFDVYTDIAFPGGIHAAWFTDTWGRYNEALDRNALHEVVGWWAKLPVTGMQPVQEDRDRSLRDGAIAAHRGNYDVHQIAGSLTFRDDVSASDPYRGQPDARLEPIGTPIESGSINLISPHNYWRDVQASGAAIYSYSGWFDGGYAHAAIKRFLTVSTPGSHLILGPWNHTGGWRVDPLRGLSRPDFDHDGELLRFIDHHVKGADTGIGSEPPVHYFTMVENRWKSADTWPPPATTQSYYLSADRQLRPDAPDCDSGADEYVVDQTAGTGERSRWRSQVGIGGHVCYPDRKAQDAKLLTYTSAPLDHPLEVTGHVVVTLFITSTSSDGTFFVYLEDVDPRGRVAYITEGQLRAIHRRLSDGPPPYRQVVPYRTFASGDAWPLVPGEIARLTFDLLPTSYLFQPGHRIRIAIAGADASHFAILPGCAPTVRVYRSRMHASRIDLPVIQP