lpqJ Family assigned · low

H37Rv Rv0344c · MTBC0 mtbc0_000364 · 186 aa · 417704–418264 (-) · RefSeq NP_214858.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqJ
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Lipoprotein LpqJ with an LpqN/LpqE-like lipid-binding fold; possible association with the respiratory supercomplex RefSeq leaves this locus uncharacterised.

Curated reference (UniProt)

UniProt O06295 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable lipoprotein LpqJ

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namelpqJ
Orthologous group2B7Q4

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.06 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0373c (carbon monoxyde dehydrogenase large subunit), medium confidence from genomic context alone (score 483 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0345 hyp hypothetical protein 594 594 ctx neighborhood:594
Rv0373c carbon monoxyde dehydrogenase large subunit 482 483 ctx neighborhood:480

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred (Neff 8.0, signal peptide): hits to M.tb lipoproteins LpqN (6E5F, lipid-binding, 89%) and LpqE (6ADQ, respiratory supercomplex, 86%) + 7Q21 supercomplex (83%) + LPS-assembly lipoprotein folds (LptM/YifL); already named LpqJ
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214858.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B7Q4
  • Curated reference: UniProt O06295 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s); context anchor Rv0373c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000364|Rv0344c|lpqJ
MRLSLIARGMAALLAATALVAGCNTTIDGRPVASPGSGPTEPTFPTPRPTTAPPGTTAPTLPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINRDSVGCEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYRTYEAQGWTIDATTDGTRFTNNRTGHGMFVSIEKVDTF