PE2 Family assigned · medium auto-curated

H37Rv Rv0152c · MTBC0 - · 525 aa · 179319–180896 (-) · RefSeq YP_177696.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE2
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE2. Pfam: PE-PPE (PF08237.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79G05 TrEMBL · unreviewed · Predicted
UniProt namePE family protein PE2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
eggNOG descriptionPE-PPE domain
Orthologous groupCOG5651

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.351 · purifying
Polymorphic sites (≥ 0.1% of strains) 24 synonymous, 23 missense, 0 nonsense, 6 frameshift
Disruption 6 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (315) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PE-PPEPF08237.18 2.5e-75111–335 PE-PPE domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE1 (PE family protein PE1), high confidence from genomic context alone (score 786 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0151c PE1 PE family protein PE1 802 786 ctx neighborhood:786
Rv0153c ptbB phosphotyrosine protein phosphatase 421 421 ctx neighborhood:421
Rv0154c fadE2 acyl-CoA dehydrogenase FadE2 419 419 ctx neighborhood:419
Rv2431c PE25 PE family protein PE25 621 155 textmining:570
Rv3896c hyp hypothetical protein 530 41 textmining:530
Rv2634c PE_PGRS46 PE-PGRS family protein PE_PGRS46 515 41 textmining:515
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 515 41 textmining:515
Rv2328 PE23 PE family protein PE23 515 41 textmining:515
Rv3893c PE36 PE family protein PE36 465 41 textmining:466
Rv3739c PPE67 PPE family protein PPE67 454 41 textmining:455
Rv1184c chp2 hyp hypothetical protein 448 41 textmining:448
Rv3902c ift hyp hypothetical protein 433 41 textmining:433
Rv3590c PE_PGRS58 PE-PGRS family protein PE_PGRS58 433 41 textmining:433
Rv3097c lipY triacylglycerol lipase Lip 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE2
  • Pfam (hmmscan --cut_ga): PE-PPE PF08237.18 (E=2e-75)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177696.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE-PPE (PF08237.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5651
  • Curated reference: UniProt Q79G05 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor PE1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0152c|PE2
MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYADAEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRCRSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWSQSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYGATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGATKLPTSPGYTGVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNYGYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLPQPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQLAAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPPTTVYRPRQ