PE2 Family assigned · medium auto-curated
H37Rv Rv0152c · MTBC0 - ·
525 aa · 179319–180896 (-) ·
RefSeq YP_177696.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE2 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE2. Pfam: PE-PPE (PF08237.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79G05
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE family protein PE2 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PE-PPE domain |
| Orthologous group | COG5651 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.351 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 24 synonymous, 23 missense, 0 nonsense, 6 frameshift |
| Disruption | 6 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (315) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE-PPE | PF08237.18 | 2.5e-75 | 111–335 | PE-PPE domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE1 (PE family protein PE1), high confidence from genomic context alone (score 786 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0151c PE1 |
PE family protein PE1 | 802 | 786 ctx | neighborhood:786 |
Rv0153c ptbB |
phosphotyrosine protein phosphatase | 421 | 421 ctx | neighborhood:421 |
Rv0154c fadE2 |
acyl-CoA dehydrogenase FadE2 | 419 | 419 ctx | neighborhood:419 |
Rv2431c PE25 |
PE family protein PE25 | 621 | 155 | textmining:570 |
Rv3896c hyp |
hypothetical protein | 530 | 41 | textmining:530 |
Rv2634c PE_PGRS46 |
PE-PGRS family protein PE_PGRS46 | 515 | 41 | textmining:515 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 515 | 41 | textmining:515 |
Rv2328 PE23 |
PE family protein PE23 | 515 | 41 | textmining:515 |
Rv3893c PE36 |
PE family protein PE36 | 465 | 41 | textmining:466 |
Rv3739c PPE67 |
PPE family protein PPE67 | 454 | 41 | textmining:455 |
Rv1184c chp2 hyp |
hypothetical protein | 448 | 41 | textmining:448 |
Rv3902c ift hyp |
hypothetical protein | 433 | 41 | textmining:433 |
Rv3590c PE_PGRS58 |
PE-PGRS family protein PE_PGRS58 | 433 | 41 | textmining:433 |
Rv3097c lipY |
triacylglycerol lipase Lip | 410 | 41 | textmining:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE2
- Pfam (hmmscan --cut_ga): PE-PPE PF08237.18 (E=2e-75)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177696.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE-PPE (PF08237.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt Q79G05 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
PE1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0152c|PE2 MRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLAAAANSYADAEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPSMLTPPIRCRSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGNAVTVFGWSQSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLPTLDLTFYGATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLTPAQVEGATKLPTSPGYTGVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVNLGYGDPNYGYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPLTLPQIQLPQPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYTTQLFVRQLAAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTDSRRHRRPPTTVYRPRQ