Rv0078B Family assigned · medium auto-curated

H37Rv Rv0078B · MTBC0 - · 68 aa · 87798–88004 (-) · RefSeq YP_007408717.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Rv0078B (PF18993.7) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X8G2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28STK

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv0078BPF18993.7 3.8e-255–64 Rv0078B-related antitoxin

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0078A hyp hypothetical protein 984 882 ctx neighborhood:882 textmining:870
Rv0079 hyp hypothetical protein 528 528 ctx neighborhood:528
Rv0080 hyp hypothetical protein 528 528 ctx neighborhood:528
Rv2827c hyp hypothetical protein 863 41 textmining:863
Rv1044 hyp hypothetical protein 815 41 textmining:815
Rv0268c hyp hypothetical protein 806 41 textmining:806
Rv2514c hyp hypothetical protein 804 41 textmining:804
Rv0269c hyp hypothetical protein 804 41 textmining:804
Rv2826c hyp hypothetical protein 679 41 textmining:679
Rv0367c hyp hypothetical protein 659 41 textmining:659
Rv2515c hyp hypothetical protein 658 41 textmining:658
Rv1045 hyp hypothetical protein 658 41 textmining:658
Rv0836c hyp hypothetical protein 657 41 textmining:657
Rv0837c hyp hypothetical protein 655 41 textmining:655
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 654 41 textmining:654

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv0078B PF18993.7 (E=4e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_007408717.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv0078B (PF18993.7)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28STK
  • Curated reference: UniProt I6X8G2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0078B|
MAVSVAAQKLRLALDMYEVGEQMQRMRLGRERPNADVVEIEAAIDAWRMTRPGAEEGDSAGPTSTRFT