Rv0089 Resolved · high auto-curated

H37Rv Rv0089 · MTBC0 - · 197 aa · 97758–98351 (+) · RefSeq NP_214603.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)methyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Methyltransferase. Pfam: Methyltransf_9 (PF08003.18), RrnaAD (PF00398.27), Methyltransf_2 (PF00891.25), MTS (PF05175.21), Ubie_methyltran (PF01209.25), PrmA (PF06325.20), Methyltransf_23 (PF13489.13), NodS (PF05401.17), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WK03 SwissProt · reviewed · Inferred from homology
UniProt nameUncharacterized methyltransferase Rv0089
EC (curated) EC 2.1.1.-

UniProt still lists this protein as Uncharacterized methyltransferase Rv0089; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionMethyltransferase domain
Orthologous groupCOG0500
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.368 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_9PF08003.18 2.8e-052–125 Protein of unknown function (DUF1698)
RrnaADPF00398.27 6.8e-0910–95 Ribosomal RNA adenine dimethylase
Methyltransf_2PF00891.25 6.7e-0611–132 O-methyltransferase domain
MTSPF05175.21 1.4e-0914–105 Methyltransferase small domain
Ubie_methyltranPF01209.25 7.7e-0914–127 ubiE/COQ5 methyltransferase family
PrmAPF06325.20 3.9e-0521–103 Ribosomal protein L11 methyltransferase (PrmA)
Methyltransf_23PF13489.13 2.7e-1224–168 Methyltransferase domain
NodSPF05401.17 3.6e-0825–118 Nodulation protein S (NodS)
Methyltransf_25PF13649.13 7.1e-2026–116 Methyltransferase domain
Methyltransf_31PF13847.13 8.6e-1126–124 Methyltransferase domain
Methyltransf_11PF08241.19 2.5e-2027–119 Methyltransferase domain
Methyltransf_12PF08242.19 8.9e-1627–118 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0090 (membrane protein), medium confidence from genomic context alone (score 623 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0090 membrane protein 622 623 ctx neighborhood:581
Rv0088 polyketide cyclase/dehydrase 564 564 ctx neighborhood:499
Rv0084 hycD formate hydrogenlyase HycD 435 435 ctx neighborhood:419
Rv0086 hycQ hydrogenase HycQ 435 435 ctx neighborhood:427
Rv0085 hycP hydrogenase HycP 435 435 ctx neighborhood:427
Rv0087 hycE formate hydrogenase HycE 434 434 ctx neighborhood:420
Rv0082 oxidoreductase 431 431 ctx neighborhood:419
Rv0083 oxidoreductase 422 422 ctx neighborhood:413
Rv0081 HTH-type transcriptional regulator 423 419 ctx neighborhood:414
Rv1570 bioD ATP-dependent dethiobiotin synthetase BioD 848 204 textmining:818
Rv1568 bioA adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA 828 134 textmining:811
Rv2715 hydrolase 870 45 textmining:870
Rv2589 gabT 4-aminobutyrate aminotransferase 618 43 textmining:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): methyltransferase
  • Pfam (hmmscan --cut_ga): Methyltransf_9 PF08003.18 (E=3e-05), RrnaAD PF00398.27 (E=7e-09), Methyltransf_2 PF00891.25 (E=7e-06), MTS PF05175.21 (E=1e-09), Ubie_methyltran PF01209.25 (E=8e-09), PrmA PF06325.20 (E=4e-05), Methyltransf_23 PF13489.13 (E=3e-12), NodS PF05401.17 (E=4e-08), Methyltransf_25 PF13649.13 (E=7e-20), Methyltransf_31 PF13847.13 (E=9e-11), Methyltransf_11 PF08241.19 (E=2e-20), Methyltransf_12 PF08242.19 (E=9e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214603.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_9 (PF08003.18), RrnaAD (PF00398.27), Methyltransf_2 (PF00891.25), MTS (PF05175.21), Ubie_methyltran (PF01209.25), PrmA (PF06325.20), Methyltransf_23 (PF13489.13), NodS (PF05401.17), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19), Methyltransf_12 (PF08242.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0500
  • Curated reference: UniProt P9WK03 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv0090
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0089|
MDQPWNANIHYDALLDAMVPLGTQCVLDVGCGDGLLAARLARRIPYVTAVDIDAPVLRRAQTRFANAPIRWLHADIMTAELPNAGFDAVVSNAALHHIEDTRTALSRLGGLVTPGGTLAVVTFVTPSLRNGLWHLTSWVACGMANRVKGKWEHSAPIKWPPPQTLHELRSHVRALLPGACIRRLLYGRVLVTWRAPV