espJ Resolved · medium auto-curated

H37Rv Rv3878 · MTBC0 mtbc0_004112 · 280 aa · 4380903–4381745 (+) · RefSeq NP_218395.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspJ
MTBC0 PGAP re-annotationtype VII secretion system ESX-1 associated protein EspJ
Revised (this work)Type VII secretion system ESX-1 associated protein EspJ.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJC3 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspJ
Curated functionCould be involved in regulation of growth and intracellular survival.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AWC2

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.538 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 3 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 8.88% of strains (12901) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: espI (ESX-1 secretion-associated protein EspI), high confidence from genomic context alone (score 824 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3876 espI ESX-1 secretion-associated protein EspI 963 824 ctx neighborhood:748 textmining:803
Rv3873 PPE68 PPE family protein PPE68 939 782 coexpression:716 textmining:735
Rv3877 eccD1 ESX-1 secretion system protein EccD1 913 762 ctx neighborhood:750 textmining:651
Rv3874 esxB ESAT-6-like protein EsxB 920 609 textmining:804
Rv3864 espE ESX-1 secretion-associated protein EspE 648 549 coexpression:411
Rv1364c sigma factor regulatory protein 524 519 coexpression:505
Rv3875 esxA ESAT-6 protein EsxA 804 449 textmining:659
Rv3866 espG1 ESX-1 secretion-associated protein EspG 536 366
Rv3869 eccB1 ESX-1 secretion system protein EccB 450 315
Rv3881c espB ESX-1 secretion-associated protein EspB 791 311 textmining:710
Rv3872 PE35 PE family protein PE35 745 223 textmining:685
Rv3879c espK ESX-1 secretion-associated protein EspK 894 222 textmining:870
Rv3871 eccCb1 ESX-1 secretion system protein EccCb 838 213 textmining:803
Rv3868 eccA1 ESX-1 secretion system protein EccA1 616 210 textmining:535
Rv3867 espH ESX-1 secretion-associated protein EspH 540 206 textmining:445

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspJ
  • MTBC0 PGAP product: type VII secretion system ESX-1 associated protein EspJ
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218395.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AWC2
  • Curated reference: UniProt P9WJC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor espI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004112|Rv3878|espJ
MAEPLAVDPTGLSAAAAKLAGLVFPQPPAPIAVSGTDSVVAAINETMPSIESLVSDGLPGVKAALTRTASNMNAAADVYAKTDQSLGTSLSQYAFGSSGEGLAGVASVGGQPSQATQLLSTPVSQVTTQLGETAAELAPRVVATVPQLVQLAPHAVQMSQNASPIAQTISQTAQQAAQSAQGGSGPMPAQLASAEKPATEQAEPVHEVTNDDQGDQGDVQPAEVVAAARDEGAGASPGQQPGGGVPAQAMDTGAGARPAASPLAAPVDPSTPAPSTTTTL