eccE2 Family assigned · medium auto-curated
H37Rv Rv3885c · MTBC0 mtbc0_004119 ·
537 aa ·
4391154–4392767 MTBC0
(-) ·
RefSeq NP_218402.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | ESX-2 secretion system protein EccE |
|---|---|
| MTBC0 PGAP re-annotation | type VII secretion system ESX-2 subunit EccE2 |
| Revised (this work) | Type VII secretion system ESX-2 subunit EccE2. Pfam: EccE (PF11203.14). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | mycP (Rv3886c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.72 (95% CI -2.05 to 4.45). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3915c
· 99.6% identity |
|---|---|
| M. orygis |
RJtmp_004001
· 99.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJE7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | ESX-2 secretion system protein EccE2 |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Putative type VII ESX secretion system translocon, EccE |
| Orthologous group | 2BMYI |
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.833 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 13 missense, 2 nonsense, 2 frameshift |
| Disruption | 4 distinct premature-stop/frameshift site(s); most common in 5.93% of strains (8606) · convergent |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 42/53 (79%) · mean identity 66.2%
· 4/4 closest MTBAP relatives conserved across the genus (present in 42/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Regions of Difference (lineage deletions)
| RD | Gene overlap | Deleted in lineages |
|---|---|---|
RDcap_Spain7 |
100% | Caprae (83%) |
This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 28 in the ORF — 0 in the essential state, 0 growth-defect, 28 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 91.3846153846. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 16.4 ppm · rank 2448/3519 (30.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (2 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 2 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 537 aa |
|---|---|
| Molecular weight | 57.7 kDa |
| Theoretical pI | 10.2 |
| GRAVY | -0.019 (hydrophilic) |
| Aliphatic index | 93.9 |
| Aromaticity | 0.054 |
| Instability index | 40.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
EccE | PF11203.14 | 1.7e-18 | 173–262 | Putative type VII ESX secretion system translocon, EccE |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6umm-assembly1_F |
1.00 | 0.74 | 5.0e-12 sig | 6umm-assembly1_F A complete structure of the ESX-3 translocon complex |
7b9s-assembly1_E |
1.00 | 0.84 | 1.2e-06 sig | 7b9s-assembly1_E Structure of the mycobacterial ESX-5 Type VII Secretion System hexameric pore complex |
6sgz-assembly1_D |
1.00 | 0.68 | 5.1e-08 sig | 6sgz-assembly1_D Structure of protomer 2 of the ESX-3 core complex |
Foldseek search of the AlphaFold DB model (mean pLDDT 87.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | eccA2 (- strand, 69 bp gap) |
|---|---|
| Downstream (3' on genome) | mycP2 (- strand, -4 bp gap) |
| Predicted operon |
eccE2 · mycP2 · eccD2 · Rv3888c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0081 (represses) · Rv0324 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: eccA2 (ESX-2 secretion system protein EccA), high confidence from genomic context alone (score 954 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3884c eccA2 |
ESX-2 secretion system protein EccA | 954 | 954 ctx | neighborhood:794 coexpression:788 |
Rv3886c mycP2 |
membrane-anchored mycosin | 928 | 928 ctx | neighborhood:881 coexpression:423 |
Rv3888c |
membrane protein | 884 | 885 ctx | neighborhood:881 |
Rv3887c eccD2 |
ESX-2 secretion system protein EccD | 884 | 885 ctx | neighborhood:881 |
Rv3889c espG2 |
ESX-2 secretion-associated protein EspG2 | 597 | 597 ctx | neighborhood:593 |
Rv3882c eccE1 |
ESX-1 secretion system protein EccE1 | 525 | 525 ctx | neighborhood:503 |
Rv3883c mycP1 |
membrane-anchored mycosin | 468 | 467 ctx | neighborhood:459 |
Rv3890c esxC |
ESAT-6 like protein EsxC | 424 | 424 ctx | neighborhood:420 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: ESX-2 secretion system protein EccE
- MTBC0 PGAP product: type VII secretion system ESX-2 subunit EccE2
- Pfam (hmmscan --cut_ga): EccE PF11203.14 (E=2e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218402.1)
- Domains: Pfam-A via hmmscan --cut_ga — EccE (PF11203.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BMYI - Curated reference: UniProt P9WJE7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
8 functional partner(s); context anchor
eccA2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004119|Rv3885c|eccE2 MTSKLTGFSPRSARRVAGVWTVFVLASAGWALGGQLGAVMAVVVGVALVFVQWWGQPAWSWAVLGLRGRRPVKWNDPITLANNRSGGGVRVQDGVAVVAVQLLGRAHRATTVTGSVTVESDNVIDVVELAPLLRHPLDLELDSISVVTFGSRTGTVGDYPRVYDAEIGTPPYAGRRETWLIMRLPVIGNTQALRWRTSVGAAAISVAQRVASSLRCQGLRAKLATATDLAELDRRLGSDAVAGSAQRWKAIRGEAGWMTTYAYPAEAISSRVLSQAWTLRADEVIQNVTVYPDATCTATITVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRGQRRCPLPAQLVTEIGPSGVLIGKLSNGDRLMIPVTDAGELSRVFVAADDTIAKRIVIRVVGAGERVCVHTRDQERWASVRMPQLSIVGTPRPAPRTTVGVVEYVRRRKNGDDGKSEGSGVDVAISPTPRPASVITIARPGTSLSESDRHGFEVTIEQIDRATVKVGAAGQNWLVEMEMFRAENRYVSLEPVTMSIGR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for eccE2? Email the maintainer — the message is pre-filled with this gene's details.