eccE2 Family assigned · medium auto-curated

H37Rv Rv3885c · MTBC0 mtbc0_004119 · 537 aa · 4391154–4392767 (-) · RefSeq NP_218402.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-2 secretion system protein EccE
MTBC0 PGAP re-annotationtype VII secretion system ESX-2 subunit EccE2
Revised (this work)Type VII secretion system ESX-2 subunit EccE2. Pfam: EccE (PF11203.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJE7 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-2 secretion system protein EccE2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPutative type VII ESX secretion system translocon, EccE
Orthologous group2BMYI
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.833 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 13 missense, 2 nonsense, 2 frameshift
Disruption 4 distinct premature-stop/frameshift site(s); most common in 5.93% of strains (8606) · convergent

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EccEPF11203.14 1.7e-18173–262 Putative type VII ESX secretion system translocon, EccE

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccA2 (ESX-2 secretion system protein EccA), high confidence from genomic context alone (score 954 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3884c eccA2 ESX-2 secretion system protein EccA 954 954 ctx neighborhood:794 coexpression:788
Rv3886c mycP2 membrane-anchored mycosin 928 928 ctx neighborhood:881 coexpression:423
Rv3888c membrane protein 884 885 ctx neighborhood:881
Rv3887c eccD2 ESX-2 secretion system protein EccD 884 885 ctx neighborhood:881
Rv3889c espG2 ESX-2 secretion-associated protein EspG2 597 597 ctx neighborhood:593
Rv3882c eccE1 ESX-1 secretion system protein EccE1 525 525 ctx neighborhood:503
Rv3883c mycP1 membrane-anchored mycosin 468 467 ctx neighborhood:459
Rv3890c esxC ESAT-6 like protein EsxC 424 424 ctx neighborhood:420

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-2 secretion system protein EccE
  • MTBC0 PGAP product: type VII secretion system ESX-2 subunit EccE2
  • Pfam (hmmscan --cut_ga): EccE PF11203.14 (E=2e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218402.1)
  • Domains: Pfam-A via hmmscan --cut_ga — EccE (PF11203.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BMYI
  • Curated reference: UniProt P9WJE7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor eccA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004119|Rv3885c|eccE2
MTSKLTGFSPRSARRVAGVWTVFVLASAGWALGGQLGAVMAVVVGVALVFVQWWGQPAWSWAVLGLRGRRPVKWNDPITLANNRSGGGVRVQDGVAVVAVQLLGRAHRATTVTGSVTVESDNVIDVVELAPLLRHPLDLELDSISVVTFGSRTGTVGDYPRVYDAEIGTPPYAGRRETWLIMRLPVIGNTQALRWRTSVGAAAISVAQRVASSLRCQGLRAKLATATDLAELDRRLGSDAVAGSAQRWKAIRGEAGWMTTYAYPAEAISSRVLSQAWTLRADEVIQNVTVYPDATCTATITVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRGQRRCPLPAQLVTEIGPSGVLIGKLSNGDRLMIPVTDAGELSRVFVAADDTIAKRIVIRVVGAGERVCVHTRDQERWASVRMPQLSIVGTPRPAPRTTVGVVEYVRRRKNGDDGKSEGSGVDVAISPTPRPASVITIARPGTSLSESDRHGFEVTIEQIDRATVKVGAAGQNWLVEMEMFRAENRYVSLEPVTMSIGR