espH Resolved · medium auto-curated

H37Rv Rv3867 · MTBC0 mtbc0_004100 · 183 aa · 4366927–4367478 (+) · RefSeq NP_218384.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ESX-1 secretion-associated protein EspH
MTBC0 PGAP re-annotationtype VII secretion system ESX-1 associated protein EspH
Revised (this work)Type VII secretion system ESX-1 associated protein EspH.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69732 SwissProt · reviewed · Evidence at protein level
UniProt nameESX-1 secretion-associated protein EspH

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameespD
eggNOG descriptioninterspecies interaction between organisms
Orthologous group2AVBJ
Gene Ontology (32) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0009605, GO:0009607, GO:0016020, GO:0035821, GO:0042221, GO:0043207, GO:0044003, GO:0044403 +20 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: eccA1 (ESX-1 secretion system protein EccA1), high confidence from genomic context alone (score 964 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3868 eccA1 ESX-1 secretion system protein EccA1 981 964 ctx neighborhood:801 coexpression:827 textmining:490
Rv3866 espG1 ESX-1 secretion-associated protein EspG 914 854 ctx neighborhood:687 coexpression:553 textmining:436
Rv3870 eccCa1 ESX-1 secretion system protein EccCa 870 831 ctx neighborhood:801
Rv3869 eccB1 ESX-1 secretion system protein EccB 849 809 ctx neighborhood:800
Rv3864 espE ESX-1 secretion-associated protein EspE 917 715 ctx neighborhood:520 coexpression:431 textmining:723
Rv3865 espF ESX-1 secretion-associated protein EspF 924 704 ctx neighborhood:687 textmining:755
Rv3871 eccCb1 ESX-1 secretion system protein EccCb 702 604 ctx neighborhood:579
Rv3873 PPE68 PPE family protein PPE68 590 590
Rv3881c espB ESX-1 secretion-associated protein EspB 713 363 textmining:568
Rv3863 hyp hypothetical protein 791 361 textmining:687
Rv3874 esxB ESAT-6-like protein EsxB 684 358 textmining:529
Rv3872 PE35 PE family protein PE35 452 357
Rv3875 esxA ESAT-6 protein EsxA 609 320 textmining:449
Rv3876 espI ESX-1 secretion-associated protein EspI 659 305 textmining:529
Rv3880c espL ESX-1 secretion-associated protein EspL 853 288 textmining:803

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ESX-1 secretion-associated protein EspH
  • MTBC0 PGAP product: type VII secretion system ESX-1 associated protein EspH
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218384.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AVBJ
  • Curated reference: UniProt O69732 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor eccA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004100|Rv3867|espH
MVDPPGNDDDHGDLDALDFSAAHTNEASPLDALDDYAPVQTDDAEGDLDALHALTERDEEPELELFTVTNPQGSVSVSTLMDGRIQHVELTDKATSMSEAQLADEIFVIADLARQKARASQYTFMVENIGELTDEDAEGSALLREFVGMTLNLPTPEEAAAAEAEVFATRYDVDYTSRYKADD