whiB6 Family assigned · medium auto-curated

H37Rv Rv3862c · MTBC0 - · 116 aa · 4338171–4338521 (-) · RefSeq NP_218379.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator WhiB6
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator WhiB6. Pfam: Whib (PF02467.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WF37 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable transcriptional regulator WhiB6
Curated functionActs as a transcriptional regulator. Probably redox-responsive. The apo- but not holo-form probably binds DNA (By similarity). The apo-form has been shown to act as a protein disulfide reductase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namewhiB6
eggNOG descriptionTranscription factor WhiB
Orthologous group2AJEQ
KEGG orthology K18957

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 9 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.23% of strains (328) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WhibPF02467.22 1.1e-0638–79 Transcription factor WhiB

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3863 hyp hypothetical protein 408 408
Rv3875 esxA ESAT-6 protein EsxA 500 155 textmining:433
Rv3416 whiB3 redox-responsive transcriptional regulator WhiB3 440 54 textmining:433
Rv0726c S-adenosylmethionine-dependent methyltransferase 444 50 textmining:439
Rv0757 phoP two component system response transcriptional positive regulator PhoP 654 47 textmining:652
Rv3219 whiB1 transcriptional regulator WhiB1 550 45 textmining:549
Rv3849 espR ESX-1 transcriptional regulator EspR 433 41 textmining:433
Rv3616c espA ESX-1 secretion-associated protein EspA 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator WhiB6
  • Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=1e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218379.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AJEQ
  • Curated reference: UniProt P9WF37 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3862c|whiB6
MRYAFAAEATTCNAFWRNVDMTVTALYEVPLGVCTQDPDRWTTTPDDEAKTLCRACPRRWLCARDAVESAGAEGLWAGVVIPESGRARAFALGQLRSLAERNGYPVRDHRVSAQSA