ald Resolved · high auto-curated

H37Rv Rv2780 · MTBC0 mtbc0_002959 · 371 aa · 3109235–3110350 (+) · RefSeq NP_217296.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)L-alanine dehydrogenase
MTBC0 PGAP re-annotationalanine dehydrogenase
Revised (this work)Alanine dehydrogenase. Pfam: AlaDh_PNT_N (PF05222.22), AlaDh_PNT_C (PF01262.28), Shikimate_DH (PF01488.27), 2-Hacid_dh_C (PF02826.26), GIDA (PF01134.29), NAD_binding_2 (PF03446.22), Pyr_redox (PF00070.34).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQB1 SwissProt · reviewed · Evidence at protein level
UniProt nameAlanine dehydrogenase
EC (curated) EC 1.4.1.1
Curated functionCatalyzes the reversible reductive amination of pyruvate to L-alanine. However, since the physiological environment of M.tuberculosis has a neutral pH, it can be assumed that the enzyme catalyzes exclusively the formation of L-alanine. May play a role in cell wall synthesis as L-alanine is an important constituent of the peptidoglycan layer.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameald
eggNOG descriptionBelongs to the AlaDH PNT family
Orthologous groupCOG0686
EC number EC 1.4.1.1
KEGG orthology K00259
KEGG pathways map00250, map00430, map01100
Gene Ontology (53) GO:0000286, GO:0001666, GO:0003674, GO:0003824, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886 +41 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.239 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 12.03% of strains (17467) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AlaDh_PNT_NPF05222.22 3.9e-484–137 Alanine dehydrogenase/PNT, N-terminal domain
AlaDh_PNT_CPF01262.28 3.1e-85141–351 Alanine dehydrogenase/PNT, C-terminal domain
Shikimate_DHPF01488.27 1.5e-05167–269 Shikimate / quinate 5-dehydrogenase
2-Hacid_dh_CPF02826.26 1.5e-06168–268 D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
GIDAPF01134.29 7.3e-05170–207 Glucose inhibited division protein A
NAD_binding_2PF03446.22 2.5e-05171–267 NAD binding domain of 6-phosphogluconate dehydrogenase
Pyr_redoxPF00070.34 9.7e-05171–219 Pyridine nucleotide-disulphide oxidoreductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pntB (NAD(P) transhydrogenase subunit beta PntB), high confidence from genomic context alone (score 908 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3423c alr alanine racemase 972 957 coexpression:779 database:800
Rv0157 pntB NAD(P) transhydrogenase subunit beta PntB 907 908 ctx fusion:900
Rv0337c aspC aspartate aminotransferase 927 901 database:900
Rv2779c Lrp/AsnC family transcriptional regulator 837 620 ctx neighborhood:618 textmining:589
Rv2778c hyp hypothetical protein 513 514 ctx neighborhood:512
Rv1188 proline dehydrogenase 446 261
Rv1832 gcvB glycine dehydrogenase 512 191 textmining:422
Rv0490 senX3 two component sensor histidine kinase SenX3 423 85
Rv0491 regX3 two component sensory transduction protein RegX 513 70 textmining:498
Rv0903c prrA two component transcriptional regulator PrrA 408 64
Rv0846c mmcO oxidase 418 60 textmining:407
Rv2220 glnA1 glutamine synthetase 464 52 textmining:458
Rv3133c devR two component transcriptional regulator DevR 438 52 textmining:432
Rv2222c glnA2 glutamine synthetase 428 52 textmining:422
Rv3859c gltB glutamate synthase large subunit 716 49 textmining:714

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: L-alanine dehydrogenase
  • MTBC0 PGAP product: alanine dehydrogenase
  • Pfam (hmmscan --cut_ga): AlaDh_PNT_N PF05222.22 (E=4e-48), AlaDh_PNT_C PF01262.28 (E=3e-85), Shikimate_DH PF01488.27 (E=2e-05), 2-Hacid_dh_C PF02826.26 (E=2e-06), GIDA PF01134.29 (E=7e-05), NAD_binding_2 PF03446.22 (E=3e-05), Pyr_redox PF00070.34 (E=1e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217296.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AlaDh_PNT_N (PF05222.22), AlaDh_PNT_C (PF01262.28), Shikimate_DH (PF01488.27), 2-Hacid_dh_C (PF02826.26), GIDA (PF01134.29), NAD_binding_2 (PF03446.22), Pyr_redox (PF00070.34)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0686
  • Curated reference: UniProt P9WQB1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor pntB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002959|Rv2780|ald
MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA