ald Resolved · high auto-curated
H37Rv Rv2780 · MTBC0 mtbc0_002959 ·
371 aa ·
3109235–3110350 MTBC0
(+) ·
RefSeq NP_217296.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | L-alanine dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | alanine dehydrogenase |
| Revised (this work) | Alanine dehydrogenase. Pfam: AlaDh_PNT_N (PF05222.22), AlaDh_PNT_C (PF01262.28), Shikimate_DH (PF01488.27), 2-Hacid_dh_C (PF02826.26), GIDA (PF01134.29), NAD_binding_2 (PF03446.22), Pyr_redox (PF00070.34). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 44 publications
44 TB publications mention this gene. 44 publication(s) discuss this gene (41 in a M. tuberculosis context, 8 in other mycobacteria — M. smegmatis (8)).
| Publication | Date |
|---|---|
| Pien Tze Huang ameliorates alcohol-associated liver disease via suppressing oxidative stress and ferroptosis. doi:10.1016/j.phymed.2026.158170 | 2026 |
| Anterolateral versus Transpedicular Decompression with Posterior Instrumentation: A Randomized Prospective Study in Paradiscal Thoracic Spine Tuberculosis. doi:10.22603/ssrr.2025-0057 | 2025 |
| A Key Metabolic Protein in Active Mycobacterium tuberculosis: Insights into Carbon, Nitrogen, and Sulfur Metabolism. doi:10.1007/978-3-031-96883-9_6 | 2026 |
| Cycloserine resistance among drug-resistant tuberculosis cases in Taiwan. doi:10.1128/spectrum.03422-24 | 2025 |
| Integrating genomic, transcriptomic, and phenotypic information to explore drug resistance in Mycobacterium tuberculosis sub-lineage 4.2.2.2. doi:10.1093/jambio/lxaf063 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
ArgR (argR), Rv0576 (Rv0576).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.36 (95% CI -0.43 to 4.46). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | May play a role in cell wall synthesis as L-alanine is an important constituent of the peptidoglycan layer [catalytic activity: L-alanine + H(2)O + NAD(+) = pyruvate + NH(3) + NADH]. |
|---|---|
| Mycobrowser EC |
1.4.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2803
· 100.0% identity |
|---|---|
| M. leprae |
ML1532
· 85.4% identity |
| M. marinum |
MMAR_1928
· 83.0% identity |
| M. smegmatis |
MSMEG_2659
· 80.6% identity |
| M. abscessus |
MAB_3100
· 77.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQB1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Alanine dehydrogenase |
| EC (curated) |
EC 1.4.1.1
|
| Curated function | Catalyzes the reversible reductive amination of pyruvate to L-alanine. However, since the physiological environment of M.tuberculosis has a neutral pH, it can be assumed that the enzyme catalyzes exclusively the formation of L-alanine. May play a role in cell wall synthesis as L-alanine is an important constituent of the peptidoglycan layer. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | ald |
| eggNOG description | Belongs to the AlaDH PNT family |
| Orthologous group | COG0686 |
| EC number |
EC 1.4.1.1
|
| KEGG orthology |
K00259
|
| KEGG pathways |
map00250, map00430, map01100
|
| Gene Ontology (53) |
GO:0000286, GO:0001666, GO:0003674, GO:0003824, GO:0005575, GO:0005576, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886 +41 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.239 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 2 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 12.03% of strains (17467) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 82.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 25 in the ORF — 0 in the essential state, 0 growth-defect, 25 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 68.92. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) nitrogen source
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| L-Alanine | nitrogen source | mutant depleted (gene required) | -1.963 | -8.66 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | -1.67 | 0.02 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 2382.0 ppm · rank 57/3519 (98.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 371 aa |
|---|---|
| Molecular weight | 38.7 kDa |
| Theoretical pI | 5.81 |
| GRAVY | 0.163 (hydrophobic) |
| Aliphatic index | 96.1 |
| Aromaticity | 0.057 |
| Instability index | 27.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AlaDh_PNT_N | PF05222.22 | 3.9e-48 | 4–137 | Alanine dehydrogenase/PNT, N-terminal domain |
AlaDh_PNT_C | PF01262.28 | 3.1e-85 | 141–351 | Alanine dehydrogenase/PNT, C-terminal domain |
Shikimate_DH | PF01488.27 | 1.5e-05 | 167–269 | Shikimate / quinate 5-dehydrogenase |
2-Hacid_dh_C | PF02826.26 | 1.5e-06 | 168–268 | D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain |
GIDA | PF01134.29 | 7.3e-05 | 170–207 | Glucose inhibited division protein A |
NAD_binding_2 | PF03446.22 | 2.5e-05 | 171–267 | NAD binding domain of 6-phosphogluconate dehydrogenase |
Pyr_redox | PF00070.34 | 9.7e-05 | 171–219 | Pyridine nucleotide-disulphide oxidoreductase |
Experimental structures (Protein Data Bank) 8 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2vhw |
X-ray diffraction | 2.0 Å | 100% |
2vhx |
X-ray diffraction | 2.0 Å | 100% |
2vhz |
X-ray diffraction | 2.04 Å | 100% |
2vhy |
X-ray diffraction | 2.3 Å | 100% |
6o7f |
X-ray diffraction | 2.303 Å | 100% |
2voe |
X-ray diffraction | 2.6 Å | 100% |
2voj |
X-ray diffraction | 2.6 Å | 100% |
2vhv |
X-ray diffraction | 2.8 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (8 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2vhw-assembly1_F |
1.00 | 0.99 | 1.6e-67 sig | 2vhw-assembly1_F Crystal structure of holo L-alanine dehydrogenase from Mycobacterium tuberculosis in the open and closed conformation |
2vhv-assembly1_A |
1.00 | 0.99 | 3.9e-66 sig | 2vhv-assembly1_A Crystal structure of the D270A mutant of L-alanine dehydrogenase from Mycobacterium tuberculosis in complex with NADH. |
2vhx-assembly1_A |
1.00 | 0.98 | 3.9e-66 sig | 2vhx-assembly1_A Crystal structure of the ternary complex of L-alanine dehydrogenase from Mycobacterium tuberculosis with NAD+ and pyruvate |
2vhx-assembly1_D |
1.00 | 0.98 | 2.1e-65 sig | 2vhx-assembly1_D Crystal structure of the ternary complex of L-alanine dehydrogenase from Mycobacterium tuberculosis with NAD+ and pyruvate |
2vhx-assembly1_C |
1.00 | 0.96 | 1.2e-64 sig | 2vhx-assembly1_C Crystal structure of the ternary complex of L-alanine dehydrogenase from Mycobacterium tuberculosis with NAD+ and pyruvate |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2779c (- strand, 65 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2781c (- strand, 14 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (8 TF) |
Rv0023 (activates) · Rv0324 (represses) · phoP (represses) · Rv1353c (activates) · Rv2779c (activates) · Rv2989 (activates) · devR (represses) · lsr2 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pntB (NAD(P) transhydrogenase subunit beta PntB), high confidence from genomic context alone (score 908 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3423c alr exp |
alanine racemase | 972 | 957 | coexpression:779 database:800 |
Rv0157 pntB |
NAD(P) transhydrogenase subunit beta PntB | 907 | 908 ctx | fusion:900 |
Rv0337c aspC exp |
aspartate aminotransferase | 927 | 901 | database:900 |
Rv2779c |
Lrp/AsnC family transcriptional regulator | 837 | 620 ctx | neighborhood:618 textmining:589 |
Rv2778c hyp |
hypothetical protein | 513 | 514 ctx | neighborhood:512 |
Rv1188 |
proline dehydrogenase | 446 | 261 | |
Rv1832 gcvB |
glycine dehydrogenase | 512 | 191 | textmining:422 |
Rv0490 senX3 |
two component sensor histidine kinase SenX3 | 423 | 85 | |
Rv0491 regX3 |
two component sensory transduction protein RegX | 513 | 70 | textmining:498 |
Rv0903c prrA |
two component transcriptional regulator PrrA | 408 | 64 | |
Rv0846c mmcO |
oxidase | 418 | 60 | textmining:407 |
Rv2220 glnA1 |
glutamine synthetase | 464 | 52 | textmining:458 |
Rv3133c devR |
two component transcriptional regulator DevR | 438 | 52 | textmining:432 |
Rv2222c glnA2 |
glutamine synthetase | 428 | 52 | textmining:422 |
Rv3859c gltB |
glutamate synthase large subunit | 716 | 49 | textmining:714 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: L-alanine dehydrogenase
- MTBC0 PGAP product: alanine dehydrogenase
- Pfam (hmmscan --cut_ga): AlaDh_PNT_N PF05222.22 (E=4e-48), AlaDh_PNT_C PF01262.28 (E=3e-85), Shikimate_DH PF01488.27 (E=2e-05), 2-Hacid_dh_C PF02826.26 (E=2e-06), GIDA PF01134.29 (E=7e-05), NAD_binding_2 PF03446.22 (E=3e-05), Pyr_redox PF00070.34 (E=1e-04)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217296.1)
- Domains: Pfam-A via hmmscan --cut_ga — AlaDh_PNT_N (PF05222.22), AlaDh_PNT_C (PF01262.28), Shikimate_DH (PF01488.27), 2-Hacid_dh_C (PF02826.26), GIDA (PF01134.29), NAD_binding_2 (PF03446.22), Pyr_redox (PF00070.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0686 - Curated reference: UniProt P9WQB1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
18 functional partner(s); context anchor
pntB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002959|Rv2780|ald MRVGIPTETKNNEFRVAITPAGVAELTRRGHEVLIQAGAGEGSAITDADFKAAGAQLVGTADQVWADADLLLKVKEPIAAEYGRLRHGQILFTFLHLAASRACTDALLDSGTTSIAYETVQTADGALPLLAPMSEVAGRLAAQVGAYHLMRTQGGRGVLMGGVPGVEPADVVVIGAGTAGYNAARIANGMGATVTVLDINIDKLRQLDAEFCGRIHTRYSSAYELEGAVKRADLVIGAVLVPGAKAPKLVSNSLVAHMKPGAVLVDIAIDQGGCFEGSRPTTYDHPTFAVHDTLFYCVANMPASVPKTSTYALTNATMPYVLELADHGWRAACRSNPALAKGLSTHEGALLSERVATDLGVPFTEPASVLA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ald? Email the maintainer — the message is pre-filled with this gene's details.