Rv2492 Resolved · medium
H37Rv Rv2492 · MTBC0 mtbc0_002654 ·
250 aa ·
2830168–2830920 MTBC0
(+) ·
RefSeq NP_217008.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Thymidylate-synthase (TS)-superfamily (hydroxymethyl)transferase acting on a deoxyuridylate-type nucleotide, a distinct non-essential locus separate from the essential thymidylate synthases ThyA/ThyX. RefSeq leaves it 'hypothetical protein'. The model superposes on MilA (a CMP hydroxymethyltransferase, PDB 5b6d) with a complete catalytic constellation at the nucleotide (nucleophile Cys151, phosphate-binding Arg175, base-reading Asp178, ribose-binding His222/Tyr224); HHpred places it 100% in the thymidylate-synthase / dCMP-hydroxymethylase superfamily. The specificity residues reassign the substrate away from the template's cytidylate: Asn186 (vs MilA Asp186) and Ser176 (deoxy-type) point to a (deoxy)uridylate (dUMP-type) substrate with one-carbon chemistry on the pyrimidine C5. Vertically conserved through the human and animal MTBC and M. canettii (an earlier anti-phage-defence hypothesis is rejected). A structural prediction; substrate narrowed, not fixed. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | Rv2491 (Rv2491, + strand) |
|---|---|
| Overlap | 11 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Lsr2 (lsr2).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.25 (95% CI -0.05 to 3.51). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2520
· 99.6% identity |
|---|---|
| M. orygis |
RJtmp_002577
· 99.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YDJ7
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Thymidylate synthase |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.705 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 10 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) MTBC-specific
| M. canettii dN/dS (deep-divergence selection) |
0.283 (low power)
· 7 consensus substitution(s) low power (7 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence) |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 32 in the ORF — 0 in the essential state, 15 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 0.688, mean read count 37.8636363636. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Physico-chemical properties (computed, ProtParam)
| Length | 250 aa |
|---|---|
| Molecular weight | 28.9 kDa |
| Theoretical pI | 7.01 |
| GRAVY | -0.306 (hydrophilic) |
| Aliphatic index | 88.1 |
| Aromaticity | 0.096 |
| Instability index | 38.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 86.1 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
5jnh-assembly1_B |
1.00 | 0.73 | 3.7e-11 sig | 5jnh-assembly1_B Crystal Structure of cytidine monophosphate hydroxymethylase MilA |
5b6d-assembly1_A |
1.00 | 0.71 | 4.2e-11 sig | 5b6d-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA with CMP |
5jnh-assembly1_A |
1.00 | 0.63 | 2.3e-12 sig | 5jnh-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA |
5b6e-assembly1_A |
1.00 | 0.70 | 6.3e-11 sig | 5b6e-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA with hmCMP |
5jp9-assembly1_A |
1.00 | 0.65 | 1.0e-10 sig | 5jp9-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA with dCMP |
5j7w-assembly2_B |
1.00 | 0.64 | 1.2e-10 sig | 5j7w-assembly2_B Enterococcus faecalis thymidylate synthase complex with methotrexate |
4xsd-assembly1_A |
1.00 | 0.64 | 7.6e-11 sig | 4xsd-assembly1_A Complex structure of thymidylate synthase from varicella zoster virus with a dUMP |
4fog-assembly2_B |
1.00 | 0.68 | 4.0e-10 sig | 4fog-assembly2_B Crystal Structure of Mtb ThyA in Complex with 5-Fluoro-dUMP and 5-methyltetrahydrofolic acid |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5jnh-assembly1_A |
1.00 | 0.66 | 5.4e-13 sig | 5jnh-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA |
5b6e-assembly1_B |
1.00 | 0.71 | 3.3e-12 sig | 5b6e-assembly1_B Crystal Structure of cytidine monophosphate hydroxymethylase MilA with hmCMP |
5jp9-assembly1_A |
1.00 | 0.67 | 9.1e-12 sig | 5jp9-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA with dCMP |
5b6e-assembly1_A |
1.00 | 0.73 | 4.3e-11 sig | 5b6e-assembly1_A Crystal Structure of cytidine monophosphate hydroxymethylase MilA with hmCMP |
1ev5-assembly1_A-2 |
1.00 | 0.66 | 2.2e-10 sig | 1ev5-assembly1_A-2 CRYSTAL STRUCTURE ANALYSIS OF ALA167 MUTANT OF ESCHERICHIA COLI |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | Rv2491 (+ strand, -11 bp gap) |
|---|---|
| Downstream (3' on genome) | vapB38 (+ strand, 52 bp gap) |
| Predicted operon |
Rv2491 · Rv2492
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0047c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: vapC38 (ribonuclease VapC38), medium confidence from genomic context alone (score 619 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2491 hyp |
hypothetical protein | 967 | 967 ctx | neighborhood:882 coexpression:731 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 778 | 778 | coexpression:778 |
Rv3114 hyp |
hypothetical protein | 754 | 739 | coexpression:730 |
Rv2763c dfrA |
dihydrofolate reductase | 749 | 715 | coexpression:699 |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 720 | 708 | coexpression:667 |
Rv2902c rnhB |
ribonuclease HII | 717 | 705 | coexpression:649 |
Rv0570 nrdZ |
vitamin B12-dependent ribonucleoside-diphosphate reductase | 688 | 659 | coexpression:647 |
Rv3051c nrdE |
ribonucleoside-diphosphate reductase subunit alpha | 687 | 658 | coexpression:646 |
Rv2116 lppK |
lipoprotein LppK | 675 | 655 | coexpression:598 |
Rv0002 dnaN |
DNA polymerase III subunit beta | 675 | 654 | coexpression:597 |
Rv2494 vapC38 |
ribonuclease VapC38 | 619 | 619 ctx | neighborhood:619 |
Rv2493 vapB38 |
antitoxin VapB38 | 619 | 619 ctx | neighborhood:619 |
Rv2697c dut |
deoxyuridine 5'-triphosphate nucleotidohydrolase | 587 | 531 | coexpression:443 |
Rv1389 gmk |
guanylate kinase | 536 | 480 | coexpression:479 |
Rv0038 hyp |
hypothetical protein | 494 | 467 | coexpression:467 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- RefSeq: hypothetical protein
- Superposition on MilA+CMP (5b6d); HHpred 100% thymidylate-synthase / dCMP-hydroxymethylase superfamily
- Competent catalytic core: Cys151, Arg175, Asp178, His222, Tyr224 at H-bonding distance of the nucleotide
- Specificity residues Asn186 + Ser176 -> (deoxy)uridylate (dUMP-type), not the template CMP
- Distinct, non-essential locus (25% id); not redundant with ThyA/ThyX
- Curated against the companion dark-enzymes re-annotation (Guyeux 2026)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217008.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt I6YDJ7 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 86.1, confident)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
35 functional partner(s); context anchor
vapC38 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: Guyeux C (2026). Structure-guided functional hypotheses for uncharacterised enzymes of Mycobacterium tuberculosis in preparation. doi:10.5281/zenodo.20571950
Ancestral MTBC0 protein sequence
>mtbc0_002654|Rv2492| MSRRIINEFGVQIYGATIGDTWAGLVRAVLDLGSQCFDEDRERIALSNVRIKSSVQNYPDLTIEEHCNSDQLKAMLDFMFNTDTMEDIDVVKSFSRGAKSYHRRIKEGRMIEFVIERLSLIPESKKAVVVFPTYEDYAAVMRNHRDDYLPCLVSIQFRLLPDGKDYVFHTTFYSRSMDAWQKGHGNLLSIAKLSDWVRENVSARIGRKIMLGPLDGMICDVHIYKETYAEACKRLANLDLRRTQFDAVRN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2492? Email the maintainer — the message is pre-filled with this gene's details.